CsaV3_5G012660 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GTCGGTGGTCCATCATGGACAGTAAGGCTTGGAAGAAGAGATTCGACCACTGCAAGCAAAGCTTTAGCAGAGAATGAGCTTCCACATTTTCAAGCAGGTCTTGATCGCTTATTTCCATCTTTTCAAATAAAGGACTTAGTACAAGAGATATGGTTGCACTCTCCG GTCGGTGGTCCATCATGGACAGTAAGGCTTGGAAGAAGAGATTCGACCACTGCAAGCAAAGCTTTAGCAGAGAATGAGCTTCCACATTTTCAAGCAGGTCTTGATCGCTTATTTCCATCTTTTCAAATAAAGGACTTAGTACAAGAGATATGGTTGCACTCTCCG GTCGGTGGTCCATCATGGACAGTAAGGCTTGGAAGAAGAGATTCGACCACTGCAAGCAAAGCTTTAGCAGAGAATGAGCTTCCACATTTTCAAGCAGGTCTTGATCGCTTATTTCCATCTTTTCAAATAAAGGACTTAGTACAAGAGATATGGTTGCACTCTCCG VGGPSWTVRLGRRDSTTASKALAENELPHFQAGLDRLFPSFQIKDLVQEIWLHSP
BLAST of CsaV3_5G012660 vs. NCBI nr
Match: AAZ42168.1 (lignin peroxidase-like, partial [Cucumis sativus]) HSP 1 Score: 83.2 bits (204), Expect = 3.1e-13 Identity = 40/46 (86.96%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. NCBI nr
Match: XP_008460239.1 (PREDICTED: lignin-forming anionic peroxidase-like [Cucumis melo]) HSP 1 Score: 80.5 bits (197), Expect = 2.0e-12 Identity = 38/46 (82.61%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. NCBI nr
Match: XP_022931633.1 (lignin-forming anionic peroxidase-like [Cucurbita moschata] >XP_022931634.1 lignin-forming anionic peroxidase-like [Cucurbita moschata]) HSP 1 Score: 74.3 bits (181), Expect = 1.4e-10 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. NCBI nr
Match: XP_022933287.1 (lignin-forming anionic peroxidase-like [Cucurbita moschata]) HSP 1 Score: 74.3 bits (181), Expect = 1.4e-10 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. NCBI nr
Match: XP_023523073.1 (lignin-forming anionic peroxidase-like, partial [Cucurbita pepo subsp. pepo]) HSP 1 Score: 74.3 bits (181), Expect = 1.4e-10 Identity = 35/46 (76.09%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TAIR10
Match: AT1G14550.1 (Peroxidase superfamily protein) HSP 1 Score: 51.2 bits (121), Expect = 2.3e-07 Identity = 27/47 (57.45%), Postives = 32/47 (68.09%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TAIR10
Match: AT1G14540.1 (Peroxidase superfamily protein) HSP 1 Score: 49.7 bits (117), Expect = 6.8e-07 Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TAIR10
Match: AT2G18140.1 (Peroxidase superfamily protein) HSP 1 Score: 46.6 bits (109), Expect = 5.7e-06 Identity = 23/45 (51.11%), Postives = 27/45 (60.00%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TAIR10
Match: AT5G05340.1 (Peroxidase superfamily protein) HSP 1 Score: 45.8 bits (107), Expect = 9.8e-06 Identity = 19/41 (46.34%), Postives = 29/41 (70.73%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TAIR10
Match: AT1G68850.1 (Peroxidase superfamily protein) HSP 1 Score: 44.3 bits (103), Expect = 2.9e-05 Identity = 24/59 (40.68%), Postives = 32/59 (54.24%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. Swiss-Prot
Match: sp|Q02200|PERX_NICSY (Lignin-forming anionic peroxidase OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 4.1e-09 Identity = 31/46 (67.39%), Postives = 34/46 (73.91%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. Swiss-Prot
Match: sp|Q4W1I8|PER1_ZINVI (Basic peroxidase OS=Zinnia violacea OX=34245 GN=POD1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 8.5e-07 Identity = 26/46 (56.52%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. Swiss-Prot
Match: sp|Q4W1I9|PER2_ZINVI (Basic peroxidase OS=Zinnia violacea OX=34245 GN=POD3 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 8.5e-07 Identity = 26/46 (56.52%), Postives = 31/46 (67.39%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. Swiss-Prot
Match: sp|Q05855|PER1_WHEAT (Peroxidase OS=Triticum aestivum OX=4565 PE=2 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 3.2e-06 Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. Swiss-Prot
Match: sp|Q9M9Q9|PER5_ARATH (Peroxidase 5 OS=Arabidopsis thaliana OX=3702 GN=PER5 PE=3 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 4.2e-06 Identity = 27/47 (57.45%), Postives = 32/47 (68.09%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TrEMBL
Match: tr|Q45L80|Q45L80_CUCSA (Peroxidase (Fragment) OS=Cucumis sativus OX=3659 GN=LPO PE=2 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 2.0e-13 Identity = 40/46 (86.96%), Postives = 40/46 (86.96%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TrEMBL
Match: tr|A0A1S3CDB5|A0A1S3CDB5_CUCME (Peroxidase OS=Cucumis melo OX=3656 GN=LOC103499118 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 38/46 (82.61%), Postives = 39/46 (84.78%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TrEMBL
Match: tr|B9S799|B9S799_RICCO (Peroxidase OS=Ricinus communis OX=3988 GN=RCOM_0774940 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.6e-10 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TrEMBL
Match: tr|A0A0A0KMA0|A0A0A0KMA0_CUCSA (Peroxidase OS=Cucumis sativus OX=3659 GN=Csa_5G262770 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 3.6e-10 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_5G012660 vs. TrEMBL
Match: tr|A0A2C9U6N5|A0A2C9U6N5_MANES (Peroxidase OS=Manihot esculenta OX=3983 GN=MANES_17G093300 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.1e-10 Identity = 34/46 (73.91%), Postives = 36/46 (78.26%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|