CsaV3_4G010600 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAATAAGCCCTTACTTAACTTGTGTTTACGTTTTATTCAATGATCGACCAAGAAATGACAAATCAGTCTTTTTCCTTTAAATAAAAAATGAGCAATTCGAGAGCT TTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAA TTTCGCAAAGCAATGAAAAAAGCTATTGAATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAA FRKAMKKAIELTEQAGTKGIQVQIAGRIDGKEIARVEWIREGRVPLQTIRAKIDYCCYPVRTIYGILGIKIWIFVDEQ
BLAST of CsaV3_4G010600 vs. NCBI nr
Match: YP_247638.1 (ribosomal protein S3 [Cucumis sativus] >YP_009004081.1 ribosomal protein S3 [Cucumis hystrix] >Q4VZN0.1 RecName: Full=30S ribosomal protein S3, chloroplastic >CAJ00797.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >AAZ94688.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ABI97455.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ABI98784.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >AHJ61423.1 ribosomal protein S3 (plastid) [Cucumis hystrix] >ALF03340.1 ribosomal protein S3 (chloroplast) [Cucumis sativus var. hardwickii] >ANF28415.1 ribosomal protein S3 (chloroplast) [Cucumis sativus var. hardwickii] >ARQ16117.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ARQ16200.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ARQ16283.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ARQ16366.1 ribosomal protein S3 (chloroplast) [Cucumis sativus] >ASY97455.1 ribosomal protein S3 (chloroplast) [Cucumis sativus var. hardwickii] >AVE15370.1 ribosomal protein S3 (chloroplast) [Cucumis sativus var. sativus]) HSP 1 Score: 161.8 bits (408), Expect = 9.7e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. NCBI nr
Match: YP_009456184.1 (ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM88705.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM88995.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89054.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89113.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89172.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89231.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89290.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89350.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89409.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89468.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89527.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89587.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89646.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89705.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89764.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89823.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89882.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM89941.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90000.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90059.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90118.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90177.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90236.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90295.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90354.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90413.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90472.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90531.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90590.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90649.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90708.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90767.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90826.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90885.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM90944.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM91003.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM91062.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AHM91295.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria] >AUJ21949.1 ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. NCBI nr
Match: AHM88822.1 (ribosomal protein S3, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. NCBI nr
Match: AHM88879.1 (ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. NCBI nr
Match: AHM88937.1 (ribosomal protein S3 (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 161.4 bits (407), Expect = 1.3e-36 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TAIR10
Match: ATCG00800.1 (structural constituent of ribosome) HSP 1 Score: 149.1 bits (375), Expect = 1.2e-36 Identity = 72/78 (92.31%), Postives = 74/78 (94.87%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TAIR10
Match: ATMG00090.1 (structural constituent of ribosome;protein binding) HSP 1 Score: 42.0 bits (97), Expect = 2.0e-04 Identity = 21/59 (35.59%), Postives = 32/59 (54.24%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. Swiss-Prot
Match: sp|Q4VZN0|RR3_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus OX=3659 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 3.2e-39 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. Swiss-Prot
Match: sp|Q332T8|RR3_LACSA (30S ribosomal protein S3, chloroplastic OS=Lactuca sativa OX=4236 GN=rps3 PE=3 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 7.3e-36 Identity = 72/76 (94.74%), Postives = 74/76 (97.37%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. Swiss-Prot
Match: sp|Q06GV8|RR3_DRIGR (30S ribosomal protein S3, chloroplastic OS=Drimys granadensis OX=224735 GN=rps3 PE=3 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.2e-35 Identity = 73/78 (93.59%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. Swiss-Prot
Match: sp|Q0G9I0|RR3_LIRTU (30S ribosomal protein S3, chloroplastic OS=Liriodendron tulipifera OX=3415 GN=rps3 PE=3 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.2e-35 Identity = 73/78 (93.59%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. Swiss-Prot
Match: sp|Q8S8V5|RR3_ATRBE (30S ribosomal protein S3, chloroplastic OS=Atropa belladonna OX=33113 GN=rps3 PE=3 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 1.6e-35 Identity = 71/78 (91.03%), Postives = 75/78 (96.15%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TrEMBL
Match: tr|A0A218KG80|A0A218KG80_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.4e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TrEMBL
Match: tr|A0A1X9Q171|A0A1X9Q171_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus OX=3659 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.4e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TrEMBL
Match: tr|W8E3G6|W8E3G6_9ROSI (Ribosomal protein S3 OS=Cucumis hystrix OX=396994 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.4e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TrEMBL
Match: tr|X2EZ87|X2EZ87_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 8.4e-37 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_4G010600 vs. TrEMBL
Match: tr|A0A249RXQ1|A0A249RXQ1_CUCME (30S ribosomal protein S3, chloroplastic OS=Cucumis melo subsp. agrestis OX=217619 GN=rps3 PE=3 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 8.4e-37 Identity = 77/78 (98.72%), Postives = 78/78 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|