CsaV3_4G004660 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAACCGCCGTAGCGACTTCAGGTTTGTCTTAATTCTTCTCGCTTTTTTCTTTTCTTCTTTTCTTCTTTCATCATTATTCTGAAATTCGGCCAGGTTTTTAGATTGATTTTCAAGTAGTCAATTTGTTTCCAGATCTTTTTGTTTTCTTCTATGGTTTATTTCTTTGCCGTCGTTCAACGCTCTCAATTTTGTTTCTGGGCTTAGGTTTAGGAGAGATTAGGGCTTTCTGGATCTCCCTGGGTTACATAGTTCGGATGCCTTTTCGAATTTCTCCCGTTTGAATGTCTTTAGTGATTTTGTATTGTATGTTTTTTAGTTTATGAGTGCATGCGATTAGGAAATAGATTTGGGTATTAATTAGATAGGAGGATTTGTGTGGTAGTGCCGTTCGACTTTCTGAAATCTCGTGTAGGCGTTCTGTAAAGATTCCTAGAATGAAAATTGTGTTGGATGATGTCGAATTGTGATTGAGTTGGAGTTGGGGTTTGTTTTTCTGTAGATGGCTCGTACCAAGCAAACTGCCCGTAAGTCTACTGGAGGAAAGGCTCCAAGGAAACAGTTGGCTACAAAGGTTTGTTCAAGTTTTTTTTGCTTGAAATTTTGTGGATGAGTTGATTTGATTTTTCTCGAGTTTTCTATTTATTTATGCATTTTTTTGTTTCTGAATTTTGTAGGCTGCTCGTAAGTCCGCCCCAACCACCGGAGGAGTGAAGAAGCCACACAGATACCGTCCTGGAACTGTTGCTCTTCGGTAAGATTGTGCACGGTTTAATTCCTTTAGGTTTCCGCTTTAGTAGGTGGAAATTGTTCAATTGGTTTGAGCAAAGGTAATAACTTTTTGGCTCCTTGTGGATCCGTGCAGTGAAATCCGTAAGTACCAGAAGAGTACTGAGCTTTTTGATCAGGAAGTTGCCCTTCCAGAGGTTGGTCCGTGAAATTGCCCAGGACTTTAAGGTTTGTTGCAACCTCTTTCATTACCTGCTTTGAGATATGTTCTTGGGTTTGATGATAGATCAAAGCTGATGTATAAAATTGCATTGTGTGTTGCAGACTGATCTGCGTTTCCAGAGCCATGCTGTTCTTGCATTGCAAGAGGCAGCCGAGGCTTACCTTGTTGGATTGTTCGAGGACACCAATCTCTGCGCCATTCATGCAAAGCGTGTGACGATAATGCCCAAAGATATCCAGTTGGCTCGGAGAATCCGAGGTGAACGTGCTTAGATGGCTCGTACCAAGCAAACTGCCCGTAAGTCTACTGGAGGAAAGGCTCCAAGGAAACAGTTGGCTACAAAGGCTGCTCGTAAGTCCGCCCCAACCACCGGAGGAGTGAAGAAGCCACACAGATACCGTCCTGGAACTGTTGCTCTTCGTGAAATCCGTAAGTACCAGAAGAGTACTGAGCTTTTTGATCAGGAAGTTGCCCTTCCAGAGACTGATCTGCGTTTCCAGAGCCATGCTGTTCTTGCATTGCAAGAGGCAGCCGAGGCTTACCTTGTTGGATTGTTCGAGGACACCAATCTCTGCGCCATTCATGCAAAGCGTGTGACGATAATGCCCAAAGATATCCAGTTGGCTCGGAGAATCCGAGGTGAACGTGCTTAG ATGGCTCGTACCAAGCAAACTGCCCGTAAGTCTACTGGAGGAAAGGCTCCAAGGAAACAGTTGGCTACAAAGGCTGCTCGTAAGTCCGCCCCAACCACCGGAGGAGTGAAGAAGCCACACAGATACCGTCCTGGAACTGTTGCTCTTCGTGAAATCCGTAAGTACCAGAAGAGTACTGAGCTTTTTGATCAGGAAGTTGCCCTTCCAGAGACTGATCTGCGTTTCCAGAGCCATGCTGTTCTTGCATTGCAAGAGGCAGCCGAGGCTTACCTTGTTGGATTGTTCGAGGACACCAATCTCTGCGCCATTCATGCAAAGCGTGTGACGATAATGCCCAAAGATATCCAGTTGGCTCGGAGAATCCGAGGTGAACGTGCTTAG MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELFDQEVALPETDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
BLAST of CsaV3_4G004660 vs. NCBI nr
Match: XP_002985522.1 (histone H3.3 isoform X2 [Selaginella moellendorffii] >XP_002987048.1 histone H3.3 isoform X2 [Selaginella moellendorffii] >XP_007018714.1 PREDICTED: histone H3.3 [Theobroma cacao] >EFJ11891.1 hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii] >EFJ13396.1 hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii] >EOY15939.1 Histone superfamily protein [Theobroma cacao]) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. NCBI nr
Match: WP_039311726.1 (hypothetical protein [Paenibacillus sp. IHB B 3415] >NP_195713.1 Histone superfamily protein [Arabidopsis thaliana] >NP_196659.1 Histone superfamily protein [Arabidopsis thaliana] >NP_849529.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001031816.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001078517.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001131417.1 uncharacterized protein LOC100192746 [Zea mays] >NP_001234218.1 histone H3 variant H3.3 [Solanum lycopersicum] >NP_001235785.1 uncharacterized LOC100305466 [Glycine max] >NP_001268032.1 histone H3.3 [Vitis vinifera] >NP_001295710.1 histone H3.3 [Jatropha curcas] >NP_001304168.1 uncharacterized LOC100194139 [Zea mays] >NP_001311109.1 histone H3.3 [Zea mays] >NP_001328124.1 Histone superfamily protein [Arabidopsis thaliana] >NP_001329167.1 Histone superfamily protein [Arabidopsis thaliana] >XP_002300726.1 histone H3.3 [Populus trichocarpa] >XP_002307702.1 histone H3.3 [Populus trichocarpa] >XP_002309961.1 histone H3.3 [Populus trichocarpa] >XP_002310848.1 histone H3.3 [Populus trichocarpa] >XP_002270349.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002278809.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002278833.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_002467760.1 histone H3.3 [Sorghum bicolor] >XP_002437756.1 histone H3.3 [Sorghum bicolor] >XP_002510489.1 histone H3.3 [Ricinus communis] >XP_002510490.1 histone H3.3 [Ricinus communis] >XP_002513959.1 histone H3.3 [Ricinus communis] >XP_002977792.1 histone H3.3 [Selaginella moellendorffii] >XP_002986910.1 histone H3.3 [Selaginella moellendorffii] >XP_003538608.1 histone H3.3 [Glycine max] >XP_003538611.1 histone H3.3 [Glycine max] >XP_003545047.1 histone H3.3 [Glycine max] >XP_003550410.1 histone H3.3 [Glycine max] >XP_003557131.1 histone H3.3 [Brachypodium distachyon] >XP_003557133.1 histone H3.3 [Brachypodium distachyon] >XP_003579868.1 histone H3.3 [Brachypodium distachyon] >XP_003589384.1 histone H3.3 [Medicago truncatula] >XP_003628560.1 histone H3.3 [Medicago truncatula] >XP_003635681.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_004146875.1 PREDICTED: histone H3.3 [Cucumis sativus] >XP_004152625.1 PREDICTED: histone H3.3 [Cucumis sativus] >XP_004237940.1 histone H3.3 [Solanum lycopersicum] >XP_004238326.1 histone H3.3 [Solanum lycopersicum] >XP_004250115.1 histone H3.3 [Solanum lycopersicum] >XP_004287213.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004288164.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004288400.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004299672.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_004499230.1 PREDICTED: histone H3.3 [Cicer arietinum] >XP_004509059.1 PREDICTED: histone H3.3 [Cicer arietinum] >XP_004952850.1 histone H3.3 [Setaria italica] >XP_004964429.1 histone H3.3 [Setaria italica] >XP_004975802.1 histone H3.3 [Setaria italica] >XP_004984150.1 histone H3.3 [Setaria italica] >XP_006342014.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006363289.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006366221.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_006284722.1 histone H3.3 [Capsella rubella] >XP_006284727.1 histone H3.3 [Capsella rubella] >XP_006302978.1 histone H3.3 [Capsella rubella] >XP_006382893.1 histone H3.3 [Populus trichocarpa] >XP_006390289.1 histone H3.3 [Eutrema salsugineum] >XP_006399597.1 histone H3.3 [Eutrema salsugineum] >XP_006426331.1 histone H3.3 [Citrus clementina] >XP_006435124.1 histone H3.3 [Citrus clementina] >XP_006466265.1 histone H3.3 [Citrus sinensis] >XP_006473607.1 histone H3.3 [Citrus sinensis] >XP_006591489.1 histone H3.3 [Glycine max] >XP_006650156.1 PREDICTED: histone H3.3 [Oryza brachyantha] >XP_006652345.1 PREDICTED: histone H3.3 [Oryza brachyantha] >XP_006655750.1 PREDICTED: histone H3.3 [Oryza brachyantha] >XP_006827997.1 histone H3.3 [Amborella trichopoda] >XP_006838082.1 histone H3.3 [Amborella trichopoda] >XP_006849278.1 histone H3.3 [Amborella trichopoda] >XP_007047866.1 PREDICTED: histone H3.3 [Theobroma cacao] >XP_007160694.1 hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris] >XP_007163667.1 hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris] >XP_007207357.1 histone H3.3 [Prunus persica] >XP_007223801.1 histone H3.3 [Prunus persica] >XP_007226054.1 histone H3.3 [Prunus persica] >XP_008235104.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008219337.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008221310.1 PREDICTED: histone H3.3 [Prunus mume] >XP_008372995.1 PREDICTED: histone H3.3 [Malus domestica] >XP_008386124.1 PREDICTED: histone H3.3 [Malus domestica] >XP_008338566.1 PREDICTED: histone H3.3 [Malus domestica] >XP_008343325.1 PREDICTED: histone H3.3 [Malus domestica] >XP_008444859.1 PREDICTED: histone H3.3 [Cucumis melo] >XP_008453806.1 PREDICTED: histone H3.3 [Cucumis melo] >XP_008645853.1 histone H3.3 isoform X1 [Zea mays] >XP_008645854.1 histone H3.3 isoform X1 [Zea mays] >XP_008645855.1 histone H3.3 isoform X1 [Zea mays] >XP_008659340.1 histone H3.3 [Zea mays] >XP_008779899.1 PREDICTED: histone H3.3 [Phoenix dactylifera] >XP_008790920.1 PREDICTED: histone H3.3 [Phoenix dactylifera] >XP_008790921.1 PREDICTED: histone H3.3 [Phoenix dactylifera] >XP_008810061.1 PREDICTED: histone H3.3 [Phoenix dactylifera] >XP_008777683.1 PREDICTED: histone H3.3 [Phoenix dactylifera] >XP_009130061.1 PREDICTED: histone H3.3 [Brassica rapa] >XP_009125263.1 PREDICTED: histone H3.3 [Brassica rapa] >XP_009131189.1 PREDICTED: histone H3.3 [Brassica rapa] >XP_009104699.1 PREDICTED: histone H3.3 [Brassica rapa] >XP_009373084.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009365825.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009339588.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009348044.1 PREDICTED: histone H3.3 [Pyrus x bretschneideri] >XP_009383133.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009391324.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009391325.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009417592.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009418322.1 PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis] >XP_009622923.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] >XP_009623907.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] >XP_009589379.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] >XP_009799309.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_009799310.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_009771876.1 PREDICTED: histone H3.3 [Nicotiana sylvestris] >XP_010061026.1 PREDICTED: histone H3.3 [Eucalyptus grandis] >XP_010027928.1 PREDICTED: histone H3.3 [Eucalyptus grandis] >XP_010105254.1 histone H3.3 [Morus notabilis] >XP_010267031.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010267040.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272988.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272989.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010272990.1 PREDICTED: histone H3.3 [Nelumbo nucifera] >XP_010419651.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431986.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431987.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010431988.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010437129.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010453132.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010491788.1 PREDICTED: histone H3.3 [Camelina sativa] >XP_010533621.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010533639.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010536364.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010539857.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010539858.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010526662.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010526992.1 PREDICTED: histone H3.3 [Tarenaya hassleriana] >XP_010679856.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] >XP_010681007.1 PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris] >XP_011016807.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011022826.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011022827.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011025928.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_010939695.1 PREDICTED: histone H3.3 [Elaeis guineensis] >XP_011028962.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_010940939.1 PREDICTED: histone H3.3 [Elaeis guineensis] >XP_011045138.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011013190.1 PREDICTED: histone H3.3 [Populus euphratica] >XP_011074645.1 histone H3.3 [Sesamum indicum] >XP_011097534.1 histone H3.3 [Sesamum indicum] >XP_011100034.1 histone H3.3 [Sesamum indicum] >XP_011459532.1 PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca] >XP_012065514.1 histone H3.3 [Jatropha curcas] >XP_012067913.1 histone H3.3 isoform X1 [Jatropha curcas] >XP_012071983.1 histone H3.3 [Jatropha curcas] >XP_012073854.1 histone H3.3 [Jatropha curcas] >XP_012469821.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469822.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469823.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012469824.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012478125.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012445646.1 PREDICTED: histone H3.3 [Gossypium raimondii] >XP_012568408.1 PREDICTED: histone H3.3 [Cicer arietinum] >XP_012845140.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_012845141.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_012856050.1 PREDICTED: histone H3.3 [Erythranthe guttata] >XP_013457505.1 histone H3.3 [Medicago truncatula] >XP_013607869.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013607873.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013612488.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013612748.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013629194.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013587978.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013587979.1 PREDICTED: histone H3.3 [Brassica oleracea var. oleracea] >XP_013731924.1 histone H3.3 [Brassica napus] >XP_013736360.1 histone H3.3 [Brassica napus] >XP_013678984.1 histone H3.3 [Brassica napus] >XP_013693331.1 histone H3.3 [Brassica napus] >XP_013726329.1 histone H3.3 [Brassica napus] >XP_013648759.1 histone H3.3 [Brassica napus] >XP_013661886.1 histone H3.3 [Brassica napus] >XP_013686983.1 histone H3.3 [Brassica napus] >XP_013729633.1 histone H3.3 [Brassica napus] >XP_014493712.1 histone H3.3 [Vigna radiata var. radiata] >XP_014493713.1 histone H3.3 [Vigna radiata var. radiata] >XP_014504575.1 histone H3.3 [Vigna radiata var. radiata] >XP_014619749.1 histone H3.3 [Glycine max] >XP_014619750.1 histone H3.3 [Glycine max] >XP_015071832.1 PREDICTED: histone H3.3 [Solanum pennellii] >XP_015076419.1 PREDICTED: histone H3.3 [Solanum pennellii] >XP_015058550.1 PREDICTED: histone H3.3 [Solanum pennellii] >XP_015166737.1 PREDICTED: histone H3.3 [Solanum tuberosum] >XP_015571442.1 histone H3.3 [Ricinus communis] >XP_015630537.1 histone H3.3 [Oryza sativa Japonica Group] >XP_015643543.1 histone H3.3 [Oryza sativa Japonica Group] >XP_015884832.1 histone H3.3 [Ziziphus jujuba] >XP_015885275.1 histone H3.3 [Ziziphus jujuba] >XP_015885276.1 histone H3.3 [Ziziphus jujuba] >XP_015890774.1 histone H3.3 [Ziziphus jujuba] >XP_015964233.1 histone H3.3 [Arachis duranensis] >XP_015964234.1 histone H3.3 [Arachis duranensis] >XP_015969656.1 histone H3.3 [Arachis duranensis] >XP_015933963.1 histone H3.3 [Arachis duranensis] >XP_016201942.1 histone H3.3 [Arachis ipaensis] >XP_016201943.1 histone H3.3 [Arachis ipaensis] >XP_016204771.1 histone H3.3 [Arachis ipaensis] >XP_016167515.1 histone H3.3 [Arachis ipaensis] >XP_016473270.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016480795.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016480796.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016490816.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016493773.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016499793.1 PREDICTED: histone H3.3 [Nicotiana tabacum] >XP_016568448.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016569188.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016573193.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016550185.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016550186.1 PREDICTED: histone H3.3 [Capsicum annuum] >XP_016748847.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016687149.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016694168.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016740763.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016740764.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016740765.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016741524.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_016742363.1 PREDICTED: histone H3.3 [Gossypium hirsutum] >XP_017228549.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] >XP_017230676.1 PREDICTED: histone H3.3 isoform X2 [Daucus carota subsp. sativus] >XP_017248172.1 PREDICTED: histone H3.3 [Daucus carota subsp. sativus] >XP_017418256.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017418257.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017430529.1 PREDICTED: histone H3.3 [Vigna angularis] >XP_017620403.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_017623178.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_017630755.1 PREDICTED: histone H3.3 [Gossypium arboreum] >XP_018447173.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018450392.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018468121.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018468122.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018474474.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018474475.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018442730.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018443026.1 PREDICTED: histone H3.3 [Raphanus sativus] >XP_018511751.1 PREDICTED: histone H3.3 [Brassica rapa] >XP_018623086.1 PREDICTED: histone H3.3 [Nicotiana tomentosiformis] >XP_018833909.1 PREDICTED: histone H3.3 [Juglans regia] >XP_018847763.1 PREDICTED: histone H3.3 [Juglans regia] >XP_018847764.1 PREDICTED: histone H3.3 [Juglans regia] >XP_018849002.1 PREDICTED: histone H3.3 [Juglans regia] >XP_018821151.1 PREDICTED: histone H3.3 [Juglans regia] >XP_019074729.1 PREDICTED: histone H3.3 [Vitis vinifera] >XP_019156140.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019172343.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019174535.1 PREDICTED: histone H3.3 [Ipomoea nil] >XP_019262398.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019245391.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019245392.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019250044.1 PREDICTED: histone H3.3 [Nicotiana attenuata] >XP_019415255.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019416534.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019416535.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019422508.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019422509.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019437643.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019439992.1 PREDICTED: histone H3.3 [Lupinus angustifolius] >XP_019702951.1 PREDICTED: histone H3.3 [Elaeis guineensis] >XP_020083113.1 histone H3.3 [Ananas comosus] >XP_020094996.1 histone H3.3 [Ananas comosus] >XP_020101034.1 histone H3.3 [Ananas comosus] >XP_020101035.1 histone H3.3 [Ananas comosus] >XP_020183056.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020186780.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020187784.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020169776.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020158083.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020158991.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020174561.1 histone H3.3 [Aegilops tauschii subsp. tauschii] >XP_020235796.1 histone H3.3 [Cajanus cajan] >XP_020210223.1 histone H3.3 [Cajanus cajan] >XP_020210235.1 histone H3.3 [Cajanus cajan] >XP_020255783.1 histone H3.3 [Asparagus officinalis] >XP_020393141.1 histone H3.3 isoform X1 [Zea mays] >XP_020571918.1 histone H3.3 [Phalaenopsis equestris] >XP_020575443.1 histone H3.3 [Phalaenopsis equestris] >XP_020582702.1 histone H3.3 [Phalaenopsis equestris] >XP_020582703.1 histone H3.3 [Phalaenopsis equestris] >XP_020582704.1 histone H3.3 [Phalaenopsis equestris] >XP_020691527.1 histone H3.3 [Dendrobium catenatum] >XP_020706026.1 histone H3.3 [Dendrobium catenatum] >XP_020672589.1 histone H3.3 [Dendrobium catenatum] >XP_020876760.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875248.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875249.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875250.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_020875251.1 histone H3.3 [Arabidopsis lyrata subsp. lyrata] >XP_021300852.1 histone H3.3 [Herrania umbratica] >XP_021318678.1 histone H3.3 [Sorghum bicolor] >XP_021604130.1 histone H3.3 [Manihot esculenta] >XP_021604131.1 histone H3.3 [Manihot esculenta] >XP_021601595.1 histone H3.3 [Manihot esculenta] >XP_021682227.1 histone H3.3 [Hevea brasiliensis] >XP_021682235.1 histone H3.3 [Hevea brasiliensis] >XP_021682246.1 histone H3.3 [Hevea brasiliensis] >XP_021677683.1 histone H3.3 [Hevea brasiliensis] >XP_021683971.1 histone H3.3 [Hevea brasiliensis] >XP_021683972.1 histone H3.3 [Hevea brasiliensis] >XP_021683973.1 histone H3.3 [Hevea brasiliensis] >XP_021692618.1 histone H3.3 [Hevea brasiliensis] >XP_021692619.1 histone H3.3 [Hevea brasiliensis] >XP_021692620.1 histone H3.3 [Hevea brasiliensis] >XP_021642193.1 histone H3.3 [Hevea brasiliensis] >XP_021642194.1 histone H3.3 [Hevea brasiliensis] >XP_021642195.1 histone H3.3 [Hevea brasiliensis] >XP_021758536.1 histone H3.3 [Chenopodium quinoa] >XP_021759838.1 histone H3.3 [Chenopodium quinoa] >XP_021725434.1 histone H3.3 [Chenopodium quinoa] >XP_021743808.1 histone H3.3 [Chenopodium quinoa] >XP_021808227.1 histone H3.3 [Prunus avium] >XP_021816370.1 histone H3.3 [Prunus avium] >XP_021831044.1 histone H3.3 [Prunus avium] >XP_021852320.1 histone H3.3 [Spinacia oleracea] >XP_021897582.1 histone H3.3 isoform X2 [Carica papaya] >XP_021900656.1 histone H3.3 [Carica papaya] >XP_022018613.1 histone H3.3 [Helianthus annuus] >XP_022034460.1 histone H3.3 [Helianthus annuus] >XP_022039836.1 histone H3.3 [Helianthus annuus] >XP_021983725.1 histone H3.3 [Helianthus annuus] >XP_021987122.1 histone H3.3 [Helianthus annuus] >XP_022012437.1 histone H3.3 [Helianthus annuus] >XP_022016556.1 histone H3.3 [Helianthus annuus] >XP_022131890.1 histone H3.3 [Momordica charantia] >XP_022136592.1 histone H3.3 [Momordica charantia] >XP_022554285.1 histone H3.3 [Brassica napus] >XP_022554306.1 histone H3.3 [Brassica napus] >XP_022759088.1 histone H3.3 [Durio zibethinus] >XP_022751107.1 histone H3.3 [Durio zibethinus] >XP_022768369.1 histone H3.3 [Durio zibethinus] >XP_022769125.1 histone H3.3 [Durio zibethinus] >XP_022773129.1 histone H3.3 [Durio zibethinus] >XP_022773130.1 histone H3.3 [Durio zibethinus] >XP_022775006.1 histone H3.3 [Durio zibethinus] >XP_022739923.1 histone H3.3 [Durio zibethinus] >XP_022894730.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022894731.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022844252.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022879547.1 histone H3.3 [Olea europaea var. sylvestris] >XP_022942250.1 histone H3.3 [Cucurbita moschata] >XP_022951615.1 histone H3.3 isoform X3 [Cucurbita moschata] >XP_022962486.1 histone H3.3 [Cucurbita moschata] >XP_022962487.1 histone H3.3 [Cucurbita moschata] >XP_022929483.1 histone H3.3 [Cucurbita moschata] >XP_022929484.1 histone H3.3 [Cucurbita moschata] >XP_022983298.1 histone H3.3 [Cucurbita maxima] >XP_022985522.1 histone H3.3 [Cucurbita maxima] >XP_022985523.1 histone H3.3 [Cucurbita maxima] >XP_022997288.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_022997289.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023002731.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023002732.1 histone H3.3 isoform X2 [Cucurbita maxima] >XP_023531730.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023537222.1 histone H3.3 isoform X2 [Cucurbita pepo subsp. pepo] >XP_023547031.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023553020.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_023553021.1 histone H3.3 [Cucurbita pepo subsp. pepo] >XP_006288773.2 histone H3.3 [Capsella rubella] >XP_023762347.1 histone H3.3 [Lactuca sativa] >XP_023767145.1 histone H3.3 [Lactuca sativa] >XP_023769112.1 histone H3.3 [Lactuca sativa] >XP_023738568.1 histone H3.3 [Lactuca sativa] >XP_023885343.1 histone H3.3 [Quercus suber] >XP_023884417.1 histone H3.3 [Quercus suber] >XP_023924801.1 histone H3.3 [Quercus suber] >XP_006411806.2 histone H3.3 isoform X2 [Eutrema salsugineum] >XP_024005719.1 histone H3.3 isoform X2 [Eutrema salsugineum] >XP_024005720.1 histone H3.3 [Eutrema salsugineum] >XP_024005721.1 histone H3.3 [Eutrema salsugineum] >XP_024027945.1 histone H3.3 [Morus notabilis] >XP_024185980.1 histone H3.3 [Rosa chinensis] >XP_024188068.1 histone H3.3 [Rosa chinensis] >XP_024162518.1 histone H3.3 [Rosa chinensis] >XP_024162520.1 histone H3.3 [Rosa chinensis] >XP_024173826.1 histone H3.3 [Rosa chinensis] >XP_024401741.1 histone H3.3 isoform X2 [Physcomitrella patens] >XP_024402425.1 histone H3.3 [Physcomitrella patens] >XP_024402426.1 histone H3.3 [Physcomitrella patens] >XP_024403257.1 histone H3.3 [Physcomitrella patens] >XP_024403258.1 histone H3.3 [Physcomitrella patens] >XP_024403259.1 histone H3.3 [Physcomitrella patens] >XP_024403260.1 histone H3.3 [Physcomitrella patens] >XP_024451503.1 histone H3.3 [Populus trichocarpa] >XP_024457821.1 histone H3.3 [Populus trichocarpa] >XP_024963143.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024963144.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969177.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969912.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024969913.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024971883.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024976044.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_024976045.1 histone H3.3 [Cynara cardunculus var. scolymus] >XP_025015280.1 histone H3.3 [Ricinus communis] >XP_025698977.1 histone H3.3 [Arachis hypogaea] >XP_025604872.1 histone H3.3 [Arachis hypogaea] >XP_025612284.1 histone H3.3 [Arachis hypogaea] >XP_025653569.1 histone H3.3 [Arachis hypogaea] >XP_025653570.1 histone H3.3 [Arachis hypogaea] >XP_025657733.1 histone H3.3 [Arachis hypogaea] >XP_025665795.1 histone H3.3 [Arachis hypogaea] >XP_025811526.1 histone H3.3 [Panicum hallii] >XP_025797925.1 histone H3.3 [Panicum hallii] >P59169.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 >Q71V89.3 RecName: Full=Histone H3.3 >P69245.2 RecName: Full=Histone H3.3 >P69244.2 RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: Full=Minor histone H3 >Q71H73.3 RecName: Full=Histone H3.3 >Q6RUR1.3 RecName: Full=Histone H3.3 >Q71U98.3 RecName: Full=Histone H3.3 >Q711T2.3 RecName: Full=Histone H3.3 >Q76N23.1 RecName: Full=Histone H3.3 >Q3C2E5.3 RecName: Full=Histone H3.3; AltName: Full=Replacement histone H3 >A2XHJ3.1 RecName: Full=Histone H3.3; AltName: Full=H3.2 >Q0JCT1.2 RecName: Full=Histone H3.3; AltName: Full=H3.2 >AAK60325.1 AT4g40030/T5J17_200 [Arabidopsis thaliana] >CAA42957.1 histone H3.3 like protein [Arabidopsis thaliana] >CAA42958.1 histone H3.3 like protein [Arabidopsis thaliana] >AAB49538.1 histone H3.2 [Medicago sativa] >AAB36493.1 histone H3.2 [Medicago sativa] >AAB36494.1 histone H3.2 [Medicago sativa] >AAB36497.1 histone H3.2 [Medicago sativa] >AAB36498.1 histone H3.2 [Medicago sativa] >CAA56153.1 histone H3 [Lolium temulentum] >CAA58445.1 histone H3 variant H3.3 [Solanum lycopersicum] >AAB97162.1 histone 3 [Gossypium hirsutum] >BAA31218.1 histone H3 [Nicotiana tabacum] >AAC78105.1 histone H3 [Oryza sativa Japonica Group] >AAC97380.1 histone H3 [Oryza coarctata] >CAB38916.1 histone H3.3 [Arabidopsis thaliana] >CAB38917.1 Histon H3 [Arabidopsis thaliana] >BAA84794.1 histone H3 [Oryza sativa Japonica Group] >CAB80666.1 histone H3.3 [Arabidopsis thaliana] >CAB80667.1 Histon H3 [Arabidopsis thaliana] >CAB96853.1 histon H3 protein [Arabidopsis thaliana] >AAL50088.1 AT5g10980/T30N20_250 [Arabidopsis thaliana] >AAL77728.1 AT4g40030/T5J17_200 [Arabidopsis thaliana] >AAM19891.1 AT5g10980/T30N20_250 [Arabidopsis thaliana] >AAM63725.1 histon H3 protein [Arabidopsis thaliana] >AAO00751.1 Histon H3 [Arabidopsis thaliana] >AAO29945.1 Histone H3 [Arabidopsis thaliana] >CAC84678.1 putative histone H3 [Pinus pinaster] >AAP30739.1 histone H3.3 [Vitis vinifera] >AAR06361.1 histone H3.2 protein [Oryza sativa Japonica Group] >AAR84425.1 histone H3-like protein [Capsicum annuum] >AAS19511.1 putative histone H3 [Oryza sativa Japonica Group] >AAX92697.1 histone 3 [Picea abies] >AAZ72655.1 histone H3.1 [Craterostigma plantagineum] >AAZ72656.1 histone H3.2 [Craterostigma plantagineum] >BAE47073.1 replacement histone H3 [Lolium multiflorum] >ABF58917.1 At4g40040 [Arabidopsis thaliana] >CAJ38369.1 histin H3 [Plantago major] >ABF96358.1 Histone H3, putative, expressed [Oryza sativa Japonica Group] >ABF96359.1 Histone H3, putative, expressed [Oryza sativa Japonica Group] >BAF12190.1 Os03g0390600 [Oryza sativa Japonica Group] >BAF18607.1 Os06g0130900 [Oryza sativa Japonica Group] >ABI97039.1 histone H3 [Robinia pseudoacacia] >CAH67105.1 H0818E04.22 [Oryza sativa] >CAH67180.1 H0815C01.1 [Oryza sativa] >ABK21404.1 unknown [Picea sitchensis] >ABK21875.1 unknown [Picea sitchensis] >ABK23002.1 unknown [Picea sitchensis] >ABK23658.1 unknown [Picea sitchensis] >ABK94527.1 unknown [Populus trichocarpa] >ABK94627.1 unknown [Populus trichocarpa] >ABK94832.1 unknown [Populus trichocarpa] >ABK96416.1 unknown [Populus trichocarpa x Populus deltoides] >EAY90303.1 hypothetical protein OsI_11878 [Oryza sativa Indica Group] >EAZ30915.1 hypothetical protein OsJ_14996 [Oryza sativa Japonica Group] >EAZ35710.1 hypothetical protein OsJ_19999 [Oryza sativa Japonica Group] >ABP04114.1 histone 3 [Lemna minor] >CAN70615.1 hypothetical protein VITISV_004842 [Vitis vinifera] >CAN80736.1 hypothetical protein VITISV_034858 [Vitis vinifera] >CAN81972.1 hypothetical protein VITISV_011984 [Vitis vinifera] >ABR16042.1 unknown [Picea sitchensis] >ABR16186.1 unknown [Picea sitchensis] >ABR16666.1 unknown [Picea sitchensis] >ABR16974.1 unknown [Picea sitchensis] >ABR16987.1 unknown [Picea sitchensis] >ABR17024.1 unknown [Picea sitchensis] >ABR18384.1 unknown [Picea sitchensis] >ABS11142.1 histone H3 [Solanum lycopersicum] >ABS83501.1 U box domain-containing protein [Oryza sativa Japonica Group] >ACA50511.1 histone H3 [Oryza sativa Japonica Group] >ACF79815.1 unknown [Zea mays] >ACF87291.1 unknown [Zea mays] >ACF88473.1 unknown [Zea mays] >ACG24535.1 histone H3 [Zea mays] >ACG24932.1 histone H3 [Zea mays] >ACG25002.1 histone H3 [Zea mays] >ACG25605.1 histone H3 [Zea mays] >ACG31041.1 histone H3 [Zea mays] >ACG31048.1 histone H3 [Zea mays] >ACG46136.1 histone H3 [Zea mays] >BAG88589.1 unnamed protein product [Oryza sativa Japonica Group] >BAG97018.1 unnamed protein product [Oryza sativa Japonica Group] >EEC77374.1 hypothetical protein OsI_16104 [Oryza sativa Indica Group] >BAH19936.1 AT4G40040 [Arabidopsis thaliana] >BAH20155.1 AT4G40040 [Arabidopsis thaliana] >EEE59182.1 hypothetical protein OsJ_11116 [Oryza sativa Japonica Group] >EEF30872.1 histone h3, putative [Ricinus communis] >EEF48542.1 histone h3, putative [Ricinus communis] >EEF52676.1 histone h3, putative [Ricinus communis] >EEF52677.1 histone h3, putative [Ricinus communis] >ACN40144.1 unknown [Picea sitchensis] >ACN41024.1 unknown [Picea sitchensis] >ACN65412.1 histone 3.2 [Pteris vittata] >ACR37697.1 unknown [Zea mays] >ACU13139.1 unknown [Glycine max] >ADE77894.1 unknown [Picea sitchensis] >ADF59039.1 histone H3.2 [Jatropha curcas] >EFH49748.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >CBI17398.3 unnamed protein product, partial [Vitis vinifera] >CBI33143.3 unnamed protein product, partial [Vitis vinifera] >ADI87404.1 histone H3 [Oryza sativa] >ADI87405.1 histone H3 [Oryza sativa] >ADI87407.1 histone H3 [Oryza sativa] >EFJ11992.1 hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] >EFJ21130.1 hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] >CBI19808.3 unnamed protein product, partial [Vitis vinifera] >ADR30795.1 histone H3.2 [Hevea brasiliensis] >ADV77197.1 histone H3, partial [Cladophora coelothrix] >BAJ86347.1 predicted protein [Hordeum vulgare subsp. vulgare] >BAK06635.1 predicted protein [Hordeum vulgare subsp. vulgare] >BAJ87590.1 predicted protein [Hordeum vulgare subsp. vulgare] >AED91617.1 Histone superfamily protein [Arabidopsis thaliana] >AEE87155.1 Histone superfamily protein [Arabidopsis thaliana] >AEE87157.1 Histone superfamily protein [Arabidopsis thaliana] >AEE87158.1 Histone superfamily protein [Arabidopsis thaliana] >AEE87159.1 Histone superfamily protein [Arabidopsis thaliana] >BAL04972.1 histone H3 [Zoysia japonica] >AES59635.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] >AET03036.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] >AEZ52395.1 histone H3 [Wolffia australiana] >AFC88829.1 histone H23-like protein, partial [Miscanthus sinensis] >AFK33416.1 unknown [Lotus japonicus] >AFK38785.1 unknown [Medicago truncatula] >AFM30053.1 histone H3 [Chimonanthus praecox] >AFP44115.1 histone H3 [Lycoris longituba] >AFR23066.1 hypothetical protein [Oryza sativa] >AFZ93649.1 histone H3 [Euphorbia lathyris] >EOA17620.1 hypothetical protein CARUB_v10005986mg [Capsella rubella] >EOA17625.1 hypothetical protein CARUB_v10005990mg [Capsella rubella] >EOA35876.1 hypothetical protein CARUB_v10021126mg [Capsella rubella] >EOX92023.1 Histone superfamily protein [Theobroma cacao] >AGN12774.1 histone H3 [Leavenworthia alabamica] >AGN12775.1 histone H3 [Leavenworthia alabamica] >AGN12782.1 histone H3 [Leavenworthia alabamica] >AGN12783.1 histone H3 [Leavenworthia alabamica] >AGN12800.1 histone H3 [Leavenworthia alabamica] >AGN12801.1 histone H3 [Leavenworthia alabamica] >EPS60563.1 hypothetical protein M569_14240 [Genlisea aurea] >EPS61796.1 hypothetical protein M569_12997 [Genlisea aurea] >AGS80253.1 histone variant H3.3 [Prunus persica] >AGS80254.1 histone variant H3.3 [Prunus persica] >AGT16456.1 histone H3 [Saccharum hybrid cultivar R570] >AGT17152.1 histone H3 [Saccharum hybrid cultivar R570] >AGV54183.1 histone H3 [Phaseolus vulgaris] >AGW30401.1 histone 3 [Oryza sativa Japonica Group] >ERM95413.1 hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda] >ERN00651.1 hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda] >ERN10859.1 hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda] >ESQ27575.1 hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum] >ESQ41050.1 hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum] >ESR39570.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] >ESR39571.1 hypothetical protein CICLE_v10026739mg [Citrus clementina] >ESR48364.1 hypothetical protein CICLE_v10002817mg [Citrus clementina] >ESW32688.1 hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris] >ESW35661.1 hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris] >EXC04189.1 Histone [Morus notabilis] >EYU21874.1 hypothetical protein MIMGU_mgv1a016051mg [Erythranthe guttata] >EYU30983.1 hypothetical protein MIMGU_mgv1a016034mg [Erythranthe guttata] >KCW54575.1 hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis] >KCW54576.1 hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis] >KCW67925.1 hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis] >KCW67926.1 hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis] >AHZ58484.1 histone H3 [Syntrichia caninervis] >KDO60693.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] >KDO60694.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] >KDO60695.1 hypothetical protein CISIN_1g032645mg [Citrus sinensis] >KDO84768.1 hypothetical protein CISIN_1g032662mg [Citrus sinensis] >KDP41416.1 hypothetical protein JCGZ_15823 [Jatropha curcas] >KEH31536.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] >CDP07429.1 unnamed protein product [Coffea canephora] >CDP01510.1 unnamed protein product [Coffea canephora] >CDP01921.1 unnamed protein product [Coffea canephora] >KFK32443.1 hypothetical protein AALP_AA6G242400 [Arabis alpina] >KFK41993.1 hypothetical protein AALP_AA2G198300 [Arabis alpina] >CDY69490.1 BnaCnng63830D [Brassica napus] >CDY68289.1 BnaAnng26750D [Brassica napus] >CDY39044.1 BnaA02g17330D [Brassica napus] >CDY13557.1 BnaC02g23680D [Brassica napus] >KGN62710.1 hypothetical protein Csa_2G369110 [Cucumis sativus] >KHG29682.1 Histone H3.3 [Gossypium arboreum] >KHL91128.1 hypothetical protein QW71_36435 [Paenibacillus sp. IHB B 3415] >KHN12662.1 Histone H3.3 [Glycine soja] >KHN31393.1 Histone H3.3 [Glycine soja] >KHN44355.1 Histone H3.3 [Glycine soja] >KHN44356.1 Histone H3.3 [Glycine soja] >KJB17321.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17322.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17323.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17324.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17325.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17326.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB17328.1 hypothetical protein B456_003G041300 [Gossypium raimondii] >KJB27557.1 hypothetical protein B456_005G111200 [Gossypium raimondii] >KJB27558.1 hypothetical protein B456_005G111200 [Gossypium raimondii] >KJB27559.1 hypothetical protein B456_005G111200 [Gossypium raimondii] >KJB58990.1 hypothetical protein B456_009G234200 [Gossypium raimondii] >KMT09530.1 hypothetical protein BVRB_6g129930 [Beta vulgaris subsp. vulgaris] >AKR53658.1 histone H3 [Oxytropis ochrocephala] >KMZ66600.1 histone H3 [Zostera marina] >KMZ71974.1 histone H3 [Zostera marina] >KNA09738.1 hypothetical protein SOVF_150870 [Spinacia oleracea] >KNA22068.1 hypothetical protein SOVF_037400 [Spinacia oleracea] >BAS30508.1 histone H3-1 [Pyramimonas parkeae] >BAS84518.1 Os03g0390600 [Oryza sativa Japonica Group] >KQJ82897.1 hypothetical protein BRADI_5g11920v3 [Brachypodium distachyon] >KQK19721.1 hypothetical protein BRADI_1g49990v3 [Brachypodium distachyon] >KRG97549.1 hypothetical protein GLYMA_18G015300 [Glycine max] >KRH17395.1 hypothetical protein GLYMA_14G217100 [Glycine max] >KRH31323.1 hypothetical protein GLYMA_11G241800 [Glycine max] >KRX12280.1 histone H3.3 [Trichinella nelsoni] >BAT82801.1 hypothetical protein VIGAN_03286800 [Vigna angularis var. angularis] >BAT86539.1 hypothetical protein VIGAN_04420500 [Vigna angularis var. angularis] >BAT86540.1 hypothetical protein VIGAN_04420600 [Vigna angularis var. angularis] >CUT18456.1 H3.3 [Lilium davidii var. unicolor] >KVH98548.1 Histone core [Cynara cardunculus var. scolymus] >KVI06500.1 Histone core [Cynara cardunculus var. scolymus] >KXG26431.1 hypothetical protein SORBI_3006G100600 [Sorghum bicolor] >KXG26432.1 hypothetical protein SORBI_3006G100600 [Sorghum bicolor] >KYP46593.1 Histone H3.3 [Cajanus cajan] >KYP75772.1 Histone H3.3 [Cajanus cajan] >KYP75774.1 Histone H3.3 [Cajanus cajan] >KZN10814.1 hypothetical protein DCAR_003470 [Daucus carota subsp. sativus] >KZV30103.1 hypothetical protein F511_19646 [Dorcoceras hygrometricum] >KZV39839.1 hypothetical protein F511_15319 [Dorcoceras hygrometricum] >KZV49786.1 hypothetical protein F511_07337 [Dorcoceras hygrometricum] >KZV50471.1 hypothetical protein F511_34915 [Dorcoceras hygrometricum] >OAE23194.1 hypothetical protein AXG93_1630s1090 [Marchantia polymorpha subsp. ruderalis] >OAE34801.1 hypothetical protein AXG93_2528s1670 [Marchantia polymorpha subsp. ruderalis] >OAO94064.1 hypothetical protein AXX17_AT5G10660 [Arabidopsis thaliana] >OAO97196.1 hypothetical protein AXX17_AT4G45480 [Arabidopsis thaliana] >OAO97921.1 hypothetical protein AXX17_AT4G45470 [Arabidopsis thaliana] >OAY23263.1 hypothetical protein MANES_18G064500 [Manihot esculenta] >OAY23264.1 hypothetical protein MANES_18G064500 [Manihot esculenta] >OAY57511.1 hypothetical protein MANES_02G102400 [Manihot esculenta] >OAY57512.1 hypothetical protein MANES_02G102400 [Manihot esculenta] >OAY62725.1 histone H3.3 [Ananas comosus] >OAY69904.1 histone H3.3 [Ananas comosus] >OAY78118.1 histone H3.3 [Ananas comosus] >ANM66215.1 Histone superfamily protein [Arabidopsis thaliana] >ANM67333.1 Histone superfamily protein [Arabidopsis thaliana] >ANS54494.1 histone H3 [Brassica rapa subsp. chinensis] >GAU45109.1 hypothetical protein TSUD_183170 [Trifolium subterraneum] >GAU41101.1 hypothetical protein TSUD_139700 [Trifolium subterraneum] >OIC47138.1 hypothetical protein A7L55_20660 [Acinetobacter baumannii] >OIC50312.1 hypothetical protein A7L55_19925 [Acinetobacter baumannii] >OIT00704.1 histone h3.3 [Nicotiana attenuata] >OIT03084.1 histone h3.3 [Nicotiana attenuata] >OIT37833.1 histone h3.3 [Nicotiana attenuata] >OIV92691.1 hypothetical protein TanjilG_18042 [Lupinus angustifolius] >OIW15037.1 hypothetical protein TanjilG_13964 [Lupinus angustifolius] >GAV81461.1 Histone domain-containing protein [Cephalotus follicularis] >GAV79343.1 Histone domain-containing protein, partial [Cephalotus follicularis] >GAV79346.1 Histone domain-containing protein, partial [Cephalotus follicularis] >OMO56148.1 histone H3 [Corchorus capsularis] >OMO75311.1 histone H3 [Corchorus olitorius] >OMO87447.1 histone H3 [Corchorus capsularis] >OMO94489.1 histone H3 [Corchorus capsularis] >OMP01270.1 histone H3 [Corchorus olitorius] >ONI02347.1 hypothetical protein PRUPE_6G192700 [Prunus persica] >ONI32468.1 hypothetical protein PRUPE_1G369600 [Prunus persica] >ONI35204.1 hypothetical protein PRUPE_1G522300 [Prunus persica] >ONI35205.1 hypothetical protein PRUPE_1G522300 [Prunus persica] >AQA28697.1 histone 3 [Hibiscus cannabinus] >ONL98646.1 Histone H3 [Zea mays] >ONL98647.1 Histone H3 [Zea mays] >ONL98649.1 Histone H3 [Zea mays] >AQK71917.1 Histone H3 [Zea mays] >AQK71918.1 Histone H3 [Zea mays] >AQK71919.1 Histone H3 [Zea mays] >AQK71920.1 Histone H3 [Zea mays] >AQK71921.1 Histone H3 [Zea mays] >AQK71922.1 Histone H3 [Zea mays] >AQK80197.1 Histone H3 [Zea mays] >AQL02337.1 Histone H3 [Zea mays] >OTF90628.1 putative histone H3/CENP-A [Helianthus annuus] >OTG16230.1 putative histone H3/CENP-A [Helianthus annuus] >OTG28011.1 putative histone H3/CENP-A [Helianthus annuus] >OTG34277.1 putative histone H3/CENP-A [Helianthus annuus] >OWM65650.1 hypothetical protein CDL15_Pgr017147 [Punica granatum] >OWM75004.1 hypothetical protein CDL15_Pgr021355 [Punica granatum] >PHT31283.1 histone H3.3 [Capsicum baccatum] >PHT48441.1 histone H3.3 [Capsicum baccatum] >PHT50720.1 histone H3.3 [Capsicum baccatum] >PHT51264.1 histone H3.3 [Capsicum baccatum] >PHT64949.1 histone H3.3 [Capsicum annuum] >PHT81914.1 histone H3.3 [Capsicum annuum] >PHT84274.1 histone H3.3 [Capsicum annuum] >PHT84919.1 histone H3.3 [Capsicum annuum] >PHU00022.1 histone H3.3 [Capsicum chinense] >PHU17682.1 histone H3.3 [Capsicum chinense] >PHU20356.1 histone H3.3 [Capsicum chinense] >PHU21106.1 histone H3.3 [Capsicum chinense] >PIA36108.1 hypothetical protein AQUCO_03400189v1 [Aquilegia coerulea] >PIA56001.1 hypothetical protein AQUCO_00700370v1 [Aquilegia coerulea] >PIA56002.1 hypothetical protein AQUCO_00700370v1 [Aquilegia coerulea] >PIM98299.1 Histones H3 and H4 [Handroanthus impetiginosus] >PIN04319.1 Histones H3 and H4 [Handroanthus impetiginosus] >PIN10462.1 Histones H3 and H4 [Handroanthus impetiginosus] >PKA47676.1 Histone H3.3 [Apostasia shenzhenica] >PKA50786.1 Histone H3.3 [Apostasia shenzhenica] >PKA59996.1 Histone H3.3 [Apostasia shenzhenica] >PKI39419.1 hypothetical protein CRG98_040177 [Punica granatum] >PKI66196.1 hypothetical protein CRG98_013364 [Punica granatum] >PKI77408.1 hypothetical protein CRG98_002181 [Punica granatum] >AUG71931.1 histone 3 [Narcissus pseudonarcissus] >PKU75353.1 Histone H3.3 [Dendrobium catenatum] >GAY38739.1 hypothetical protein CUMW_038970 [Citrus unshiu] >PLY70081.1 hypothetical protein LSAT_4X114681 [Lactuca sativa] >PLY81406.1 hypothetical protein LSAT_9X73101 [Lactuca sativa] >PLY82951.1 hypothetical protein LSAT_1X16160 [Lactuca sativa] >PNR35131.1 hypothetical protein PHYPA_023030 [Physcomitrella patens] >PNR35234.1 hypothetical protein PHYPA_023133 [Physcomitrella patens] >PNT26484.1 hypothetical protein POPTR_007G014300v3 [Populus trichocarpa] >PNT26485.1 hypothetical protein POPTR_007G014300v3 [Populus trichocarpa] >PNT28035.1 hypothetical protein POPTR_007G096700v3 [Populus trichocarpa] >PNT28036.1 hypothetical protein POPTR_007G096700v3 [Populus trichocarpa] >PNT35361.1 hypothetical protein POPTR_005G072300v3 [Populus trichocarpa] >PNT35363.1 hypothetical protein POPTR_005G072300v3 [Populus trichocarpa] >PNT35364.1 hypothetical protein POPTR_005G072300v3 [Populus trichocarpa] >PNT35365.1 hypothetical protein POPTR_005G072300v3 [Populus trichocarpa] >PNT38366.1 hypothetical protein POPTR_005G235700v3 [Populus trichocarpa] >PNT47459.1 hypothetical protein POPTR_002G026800v3 [Populus trichocarpa] >PNT47460.1 hypothetical protein POPTR_002G026800v3 [Populus trichocarpa] >PNT48877.1 hypothetical protein POPTR_002G100200v3 [Populus trichocarpa] >PNT76594.1 hypothetical protein BRADI_1g49997v3 [Brachypodium distachyon] >POE95280.1 histone H3.3 [Quercus suber] >PPD83288.1 hypothetical protein GOBAR_DD19786 [Gossypium barbadense] >PPD83289.1 hypothetical protein GOBAR_DD19787 [Gossypium barbadense] >PPE00884.1 hypothetical protein GOBAR_DD02083 [Gossypium barbadense] >PPS19608.1 hypothetical protein GOBAR_AA00958 [Gossypium barbadense] >PPS19609.1 hypothetical protein GOBAR_AA00959 [Gossypium barbadense] >PRQ21746.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ27155.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ27162.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PRQ45818.1 putative transcription factor Hap3/NF-YB family [Rosa chinensis] >PSR99862.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS17385.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS21492.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS26560.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS30134.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS31285.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS31620.1 histone H3.3 [Actinidia chinensis var. chinensis] >PSS36676.1 histone H3.3 [Actinidia chinensis var. chinensis] >PTQ31889.1 hypothetical protein MARPO_0105s0008 [Marchantia polymorpha] >PTQ40875.1 hypothetical protein MARPO_0037s0056 [Marchantia polymorpha] >PUZ62376.1 hypothetical protein GQ55_4G352300 [Panicum hallii var. hallii] >PVH48493.1 hypothetical protein PAHAL_4G341300 [Panicum hallii] >PWA59407.1 histone H3.3 [Artemisia annua] >PWA62253.1 histone H3.3 [Artemisia annua] >PWA67866.1 histone H3.3 [Artemisia annua] >PWA77082.1 histone H3.3 [Artemisia annua] >PWA92164.1 histone H3.3 [Artemisia annua] >PWZ19529.1 histone H3.3 [Zea mays] >PWZ53264.1 histone H3.3 [Zea mays] >AWW15226.1 histone H3 [Leavenworthia alabamica] >AWW15227.1 histone H3 [Leavenworthia alabamica] >AWW15245.1 histone H3 [Leavenworthia alabamica] >AWW15246.1 histone H3 [Leavenworthia alabamica] >RAL52990.1 hypothetical protein DM860_016225 [Cuscuta australis] >RAL54169.1 hypothetical protein DM860_004640 [Cuscuta australis] >GBG71910.1 hypothetical protein CBR_g10846 [Chara braunii] >SPT18570.1 unnamed protein product [Triticum aestivum] >RCV06938.1 hypothetical protein SETIT_1G204100v2 [Setaria italica] >RCV20004.1 hypothetical protein SETIT_4G020800v2 [Setaria italica] >RCV33884.1 hypothetical protein SETIT_7G118500v2 [Setaria italica]) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. NCBI nr
Match: EOA21671.1 (hypothetical protein CARUB_v10002094mg, partial [Capsella rubella]) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. NCBI nr
Match: XP_007163668.1 (hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris] >ESW35662.1 hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris]) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. NCBI nr
Match: XP_003552025.2 (histone H3.3 [Glycine max] >KRG97548.1 hypothetical protein GLYMA_18G015200 [Glycine max]) HSP 1 Score: 213.4 bits (542), Expect = 4.5e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TAIR10
Match: AT4G40040.1 (Histone superfamily protein) HSP 1 Score: 213.4 bits (542), Expect = 8.2e-56 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TAIR10
Match: AT4G40030.2 (Histone superfamily protein) HSP 1 Score: 213.4 bits (542), Expect = 8.2e-56 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TAIR10
Match: AT5G10980.1 (Histone superfamily protein) HSP 1 Score: 213.4 bits (542), Expect = 8.2e-56 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TAIR10
Match: AT1G75600.1 (Histone superfamily protein) HSP 1 Score: 205.3 bits (521), Expect = 2.2e-53 Identity = 113/136 (83.09%), Postives = 118/136 (86.76%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TAIR10
Match: AT1G09200.1 (Histone superfamily protein) HSP 1 Score: 204.5 bits (519), Expect = 3.8e-53 Identity = 113/136 (83.09%), Postives = 118/136 (86.76%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. Swiss-Prot
Match: sp|P59169|H33_ARATH (Histone H3.3 OS=Arabidopsis thaliana OX=3702 GN=HTR4 PE=1 SV=2) HSP 1 Score: 213.4 bits (542), Expect = 1.5e-54 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. Swiss-Prot
Match: sp|Q6RUR1|H33_CAPAN (Histone H3.3 OS=Capsicum annuum OX=4072 PE=2 SV=3) HSP 1 Score: 213.4 bits (542), Expect = 1.5e-54 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. Swiss-Prot
Match: sp|Q71V89|H33_GOSHI (Histone H3.3 OS=Gossypium hirsutum OX=3635 GN=HIS3 PE=2 SV=3) HSP 1 Score: 213.4 bits (542), Expect = 1.5e-54 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. Swiss-Prot
Match: sp|Q3C2E5|H33_LOLMU (Histone H3.3 OS=Lolium multiflorum OX=4521 GN=RH3 PE=2 SV=3) HSP 1 Score: 213.4 bits (542), Expect = 1.5e-54 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. Swiss-Prot
Match: sp|P69245|H33_LOLTE (Histone H3.3 OS=Lolium temulentum OX=34176 PE=2 SV=2) HSP 1 Score: 213.4 bits (542), Expect = 1.5e-54 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TrEMBL
Match: tr|A0A0V0RDG7|A0A0V0RDG7_9BILA (Histone H3 OS=Trichinella nelsoni OX=6336 GN=T07_6184 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TrEMBL
Match: tr|A0A1S4BPN0|A0A1S4BPN0_TOBAC (Histone H3 OS=Nicotiana tabacum OX=4097 GN=LOC107810536 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TrEMBL
Match: tr|A0A1R3GDG5|A0A1R3GDG5_COCAP (Histone H3 OS=Corchorus capsularis OX=210143 GN=CCACVL1_05973 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TrEMBL
Match: tr|A0A2G5CXX1|A0A2G5CXX1_AQUCA (Histone H3 OS=Aquilegia coerulea OX=218851 GN=AQUCO_00700370v1 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
BLAST of CsaV3_4G004660 vs. TrEMBL
Match: tr|A0A1U8EUX8|A0A1U8EUX8_CAPAN (Histone H3 OS=Capsicum annuum OX=4072 GN=LOC107850289 PE=3 SV=1) HSP 1 Score: 213.4 bits (542), Expect = 3.0e-52 Identity = 117/136 (86.03%), Postives = 121/136 (88.97%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|