CsaV3_3G040400 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.TTTTCCACCTATCGGGTTGTTTCCAAAATCCCATCACCAGTTAGAGATTTCAGTACCATTTCAAATCTTGCTCGTAGTAACTGGTTGATTAAAAAGCTTGGTAAAGAAGGAAAAATTGGAGAAGCACGTAAGGTTTTTGAGGAAATGCCTGATCGAGATGTGGTCTCATGA TTTTCCACCTATCGGGTTGTTTCCAAAATCCCATCACCAGTTAGAGATTTCAGTACCATTTCAAATCTTGCTCGTAGTAACTGGTTGATTAAAAAGCTTGGTAAAGAAGGAAAAATTGGAGAAGCACGTAAGGTTTTTGAGGAAATGCCTGATCGAGATGTGGTCTCATGA TTTTCCACCTATCGGGTTGTTTCCAAAATCCCATCACCAGTTAGAGATTTCAGTACCATTTCAAATCTTGCTCGTAGTAACTGGTTGATTAAAAAGCTTGGTAAAGAAGGAAAAATTGGAGAAGCACGTAAGGTTTTTGAGGAAATGCCTGATCGAGATGTGGTCTCATGA FSTYRVVSKIPSPVRDFSTISNLARSNWLIKKLGKEGKIGEARKVFEEMPDRDVVS
BLAST of CsaV3_3G040400 vs. NCBI nr
Match: KGN59466.1 (hypothetical protein Csa_3G822180 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 9.8e-23 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. NCBI nr
Match: KGN59463.1 (hypothetical protein Csa_3G822150 [Cucumis sativus]) HSP 1 Score: 93.6 bits (231), Expect = 2.3e-16 Identity = 46/56 (82.14%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. NCBI nr
Match: XP_016899654.1 (PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like, partial [Cucumis melo]) HSP 1 Score: 92.8 bits (229), Expect = 4.0e-16 Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. NCBI nr
Match: XP_022935077.1 (pentatricopeptide repeat-containing protein At2g35030, mitochondrial [Cucurbita moschata]) HSP 1 Score: 90.9 bits (224), Expect = 1.5e-15 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. NCBI nr
Match: XP_022983729.1 (pentatricopeptide repeat-containing protein At2g35030, mitochondrial [Cucurbita maxima]) HSP 1 Score: 90.9 bits (224), Expect = 1.5e-15 Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TAIR10
Match: AT2G35030.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 43.9 bits (102), Expect = 3.9e-05 Identity = 29/69 (42.03%), Postives = 37/69 (53.62%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. Swiss-Prot
Match: sp|O64766|PP185_ARATH (Pentatricopeptide repeat-containing protein At2g35030, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-E15 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 7.0e-04 Identity = 29/69 (42.03%), Postives = 37/69 (53.62%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TrEMBL
Match: tr|A0A0A0LHH2|A0A0A0LHH2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G822180 PE=4 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 6.5e-23 Identity = 56/56 (100.00%), Postives = 56/56 (100.00%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TrEMBL
Match: tr|A0A0A0LCG2|A0A0A0LCG2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G822150 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.5e-16 Identity = 46/56 (82.14%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TrEMBL
Match: tr|A0A1S4DUJ7|A0A1S4DUJ7_CUCME (LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like OS=Cucumis melo OX=3656 GN=LOC103486900 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.6e-16 Identity = 48/56 (85.71%), Postives = 50/56 (89.29%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TrEMBL
Match: tr|A0A1S3B8F2|A0A1S3B8F2_CUCME (pentatricopeptide repeat-containing protein At2g35030, mitochondrial OS=Cucumis melo OX=3656 GN=LOC103486904 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.2e-15 Identity = 46/56 (82.14%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of CsaV3_3G040400 vs. TrEMBL
Match: tr|A0A2P6SCQ9|A0A2P6SCQ9_ROSCH (Putative tetratricopeptide-like helical domain, DYW domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0336671 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 2.4e-09 Identity = 30/54 (55.56%), Postives = 43/54 (79.63%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|