CsaV3_3G028040 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.CTCATTTGGGTCAAACCTGACTACAAGTAGCAGTTCATCTGAAAACATCTTTGCGGCTCTCATTACCATTATTGGGATCCTTCTAGTTGTTTATCTTATCGGCAACTTGCAGGTTTGTTAAAGATCTTCTCATCCAATATGTAAACCTTTCCTTTTCTAAGTCAGTAACAAAGAAATGACTGCATCTTTAAACAGGTATATCTGCAGTCCTCAACTTTAAGATCAGAGGAGAAACGGAGGACGATGAAAAAGAAAGATGGTGAAATAGATTTCTGGATAGATTATTATGAGTTTCAGAAGAAGAAGGAAATCAAGGAGTTTGTGAGAGACAAGTTTGAGTGGAAAAATGATGTCAATTTGAAAACACTGCTCGACGTGTTTCCGTCTCCATTCGTTGAGGAGATAAAGAAAGAACTTTGA TCATTTGGGTCAAACCTGACTACAAGTAGCAGTTCATCTGAAAACATCTTTGCGGCTCTCATTACCATTATTGGGATCCTTCTAGTTGTTTATCTTATCGGCAACTTGCAGGTATATCTGCAGTCCTCAACTTTAAGATCAGAGGAGAAACGGAGGACGATGAAAAAGAAAGATGGTGAAATAGATTTCTGGATAGATTATTATGAGTTTCAGAAGAAGAAGGAAATCAAGGAGTTTGTGAGAGACAAGTTTGAGTGGAAAAATGATGTCAATTTGAAAACACTGCTCGACGTGTTTCCGTCTCCATTCGTTGAGGAGATAAAGAAAGAACTTTGA TCATTTGGGTCAAACCTGACTACAAGTAGCAGTTCATCTGAAAACATCTTTGCGGCTCTCATTACCATTATTGGGATCCTTCTAGTTGTTTATCTTATCGGCAACTTGCAGGTATATCTGCAGTCCTCAACTTTAAGATCAGAGGAGAAACGGAGGACGATGAAAAAGAAAGATGGTGAAATAGATTTCTGGATAGATTATTATGAGTTTCAGAAGAAGAAGGAAATCAAGGAGTTTGTGAGAGACAAGTTTGAGTGGAAAAATGATGTCAATTTGAAAACACTGCTCGACGTGTTTCCGTCTCCATTCGTTGAGGAGATAAAGAAAGAACTTTGA SFGSNLTTSSSSSENIFAALITIIGILLVVYLIGNLQVYLQSSTLRSEEKRRTMKKKDGEIDFWIDYYEFQKKKEIKEFVRDKFEWKNDVNLKTLLDVFPSPFVEEIKKEL
BLAST of CsaV3_3G028040 vs. NCBI nr
Match: XP_008449547.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 192.2 bits (487), Expect = 9.5e-46 Identity = 102/111 (91.89%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. NCBI nr
Match: XP_016900694.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo] >XP_016900695.1 PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X3 [Cucumis melo]) HSP 1 Score: 192.2 bits (487), Expect = 9.5e-46 Identity = 102/111 (91.89%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. NCBI nr
Match: XP_011651603.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X1 [Cucumis sativus]) HSP 1 Score: 186.8 bits (473), Expect = 4.0e-44 Identity = 98/111 (88.29%), Postives = 102/111 (91.89%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. NCBI nr
Match: XP_011651604.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis sativus]) HSP 1 Score: 186.8 bits (473), Expect = 4.0e-44 Identity = 98/111 (88.29%), Postives = 102/111 (91.89%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. NCBI nr
Match: XP_016900693.1 (PREDICTED: cyclic nucleotide-gated ion channel 1-like isoform X2 [Cucumis melo]) HSP 1 Score: 179.1 bits (453), Expect = 8.3e-42 Identity = 98/111 (88.29%), Postives = 100/111 (90.09%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TAIR10
Match: AT2G24610.1 (cyclic nucleotide-gated channel 14) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 41/113 (36.28%), Postives = 69/113 (61.06%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TAIR10
Match: AT4G30360.1 (cyclic nucleotide-gated channel 17) HSP 1 Score: 57.0 bits (136), Expect = 8.7e-09 Identity = 43/115 (37.39%), Postives = 68/115 (59.13%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TAIR10
Match: AT2G46430.1 (cyclic nucleotide gated channel 3) HSP 1 Score: 56.6 bits (135), Expect = 1.1e-08 Identity = 41/113 (36.28%), Postives = 65/113 (57.52%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TAIR10
Match: AT2G46440.1 (cyclic nucleotide-gated channels) HSP 1 Score: 55.8 bits (133), Expect = 1.9e-08 Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TAIR10
Match: AT2G28260.1 (cyclic nucleotide-gated channel 15) HSP 1 Score: 53.9 bits (128), Expect = 7.3e-08 Identity = 42/115 (36.52%), Postives = 67/115 (58.26%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. Swiss-Prot
Match: sp|Q9SJA4|CNG14_ARATH (Probable cyclic nucleotide-gated ion channel 14 OS=Arabidopsis thaliana OX=3702 GN=CNGC14 PE=2 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 2.4e-08 Identity = 41/113 (36.28%), Postives = 69/113 (61.06%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. Swiss-Prot
Match: sp|Q8L7Z0|CNG17_ARATH (Cyclic nucleotide-gated ion channel 17 OS=Arabidopsis thaliana OX=3702 GN=CNGC17 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.6e-07 Identity = 43/115 (37.39%), Postives = 68/115 (59.13%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. Swiss-Prot
Match: sp|Q9SKD7|CNGC3_ARATH (Probable cyclic nucleotide-gated ion channel 3 OS=Arabidopsis thaliana OX=3702 GN=CNGC3 PE=2 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 2.0e-07 Identity = 41/113 (36.28%), Postives = 65/113 (57.52%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. Swiss-Prot
Match: sp|Q9SKD6|CNG11_ARATH (Cyclic nucleotide-gated ion channel 11 OS=Arabidopsis thaliana OX=3702 GN=CNGC11 PE=2 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 41/113 (36.28%), Postives = 60/113 (53.10%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. Swiss-Prot
Match: sp|Q9SL29|CNG15_ARATH (Putative cyclic nucleotide-gated ion channel 15 OS=Arabidopsis thaliana OX=3702 GN=CNGC15 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.3e-06 Identity = 42/115 (36.52%), Postives = 67/115 (58.26%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TrEMBL
Match: tr|A0A1S4DYA3|A0A1S4DYA3_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 6.3e-46 Identity = 102/111 (91.89%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TrEMBL
Match: tr|A0A1S3BLM4|A0A1S3BLM4_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 192.2 bits (487), Expect = 6.3e-46 Identity = 102/111 (91.89%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TrEMBL
Match: tr|A0A1S4DXJ0|A0A1S4DXJ0_CUCME (cyclic nucleotide-gated ion channel 1-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103491398 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 5.5e-42 Identity = 98/111 (88.29%), Postives = 100/111 (90.09%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TrEMBL
Match: tr|A0A0A0LBE9|A0A0A0LBE9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G606870 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 1.1e-21 Identity = 69/111 (62.16%), Postives = 72/111 (64.86%), Query Frame = 0
BLAST of CsaV3_3G028040 vs. TrEMBL
Match: tr|A0A2P6SP51|A0A2P6SP51_ROSCH (Putative Ion transport domain, transcription regulator, NtcA OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0381221 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.6e-15 Identity = 55/117 (47.01%), Postives = 75/117 (64.10%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|