CsaV3_3G025140 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAAGGGAAGATCGTTGTGATTCGTGATTGGGAAGTACCAAGGTCAGTCACTGACTTGCGCTCCTTCCTCGGGTTAGCCAATTATTACAGGCGATTCGTGGAAGGATTCTCTAAAAGAGCAAGCCCGTTGACTGACTTGCTGAAGAAGGACAACAAGTGGAATTGGACACCGAAAT ATGGAGGAAGGGAAGATCGTTGTGATTCGTGATTGGGAAGTACCAAGGTCAGTCACTGACTTGCGCTCCTTCCTCGGGTTAGCCAATTATTACAGGCGATTCGTGGAAGGATTCTCTAAAAGAGCAAGCCCGTTGACTGACTTGCTGAAGAAGGACAACAAGTGGAATTGGACACCGAAAT ATGGAGGAAGGGAAGATCGTTGTGATTCGTGATTGGGAAGTACCAAGGTCAGTCACTGACTTGCGCTCCTTCCTCGGGTTAGCCAATTATTACAGGCGATTCGTGGAAGGATTCTCTAAAAGAGCAAGCCCGTTGACTGACTTGCTGAAGAAGGACAACAAGTGGAATTGGACACCGAAAT MEEGKIVVIRDWEVPRSVTDLRSFLGLANYYRRFVEGFSKRASPLTDLLKKDNKWNWTPKX
BLAST of CsaV3_3G025140 vs. NCBI nr
Match: XP_022155185.1 (uncharacterized protein LOC111022320 [Momordica charantia]) HSP 1 Score: 106.7 bits (265), Expect = 2.9e-20 Identity = 44/60 (73.33%), Postives = 54/60 (90.00%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. NCBI nr
Match: XP_022154926.1 (uncharacterized protein LOC111022072 [Momordica charantia]) HSP 1 Score: 98.2 bits (243), Expect = 1.0e-17 Identity = 43/60 (71.67%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. NCBI nr
Match: XP_022975516.1 (uncharacterized protein LOC111474945, partial [Cucurbita maxima]) HSP 1 Score: 96.3 bits (238), Expect = 3.9e-17 Identity = 41/58 (70.69%), Postives = 52/58 (89.66%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. NCBI nr
Match: CAN76063.1 (hypothetical protein VITISV_040632 [Vitis vinifera]) HSP 1 Score: 95.5 bits (236), Expect = 6.6e-17 Identity = 39/58 (67.24%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. NCBI nr
Match: XP_021600680.1 (uncharacterized protein LOC110606236 [Manihot esculenta]) HSP 1 Score: 95.5 bits (236), Expect = 6.6e-17 Identity = 41/60 (68.33%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TAIR10
Match: ATMG00860.1 (DNA/RNA polymerases superfamily protein) HSP 1 Score: 60.5 bits (145), Expect = 4.3e-10 Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. Swiss-Prot
Match: sp|P92523|M860_ARATH (Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana OX=3702 GN=AtMg00860 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 7.7e-09 Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. Swiss-Prot
Match: sp|Q9UR07|TF211_SCHPO (Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-11 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.2e-08 Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. Swiss-Prot
Match: sp|P0CT41|TF212_SCHPO (Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-12 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.2e-08 Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. Swiss-Prot
Match: sp|P0CT34|TF21_SCHPO (Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-1 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.2e-08 Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. Swiss-Prot
Match: sp|P0CT35|TF22_SCHPO (Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-2 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.2e-08 Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TrEMBL
Match: tr|A5AUJ7|A5AUJ7_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_040632 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.4e-17 Identity = 39/58 (67.24%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TrEMBL
Match: tr|A5C4Y8|A5C4Y8_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_025158 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 7.4e-17 Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TrEMBL
Match: tr|A5CBC2|A5CBC2_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_010464 PE=4 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 2.2e-16 Identity = 38/58 (65.52%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TrEMBL
Match: tr|A5BVZ5|A5BVZ5_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_028502 PE=4 SV=1) HSP 1 Score: 92.8 bits (229), Expect = 2.8e-16 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of CsaV3_3G025140 vs. TrEMBL
Match: tr|A5AXU3|A5AXU3_VITVI (Uncharacterized protein OS=Vitis vinifera OX=29760 GN=VITISV_031913 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 3.7e-16 Identity = 38/58 (65.52%), Postives = 49/58 (84.48%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |