CsaV3_3G010970 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.GATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGTTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTTGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGTATTTCATGATGGAGTAAAGCAAGGCATTCGCAAGCTCAAAAGAAAGGATGTATGTTTTTTTTTTGTTTTTGTTTTTAAAATTTATTTATCCAATATTTATATTTATATATTTATTTATAGAGGTGGTAAGGATAGATGACTACAACATTGTACGTCCAAGTGAGTGGGCTTTAAAGTCCTTGTTAAGCAAACACCCAGTTTGTATCAGCATTTCTGTTGATGAATATGGTATGTATAGAAATTACAGAGGCAGACTTTACTATGGTCCGTTGGGAGAAATAGCAAATCATTCCATGTTAGCAGTAGGGTATAGTAAAGACTACTTGCTGCTCAAAAACTCATGGGGATGTATCTGGGGAGAAAATGGATATTGCAGAATCGCCACTCAACAA GATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGTTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTTGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGGTATAGTAAAGACTACTTGCTGCTCAAAAACTCATGGGGATGTATCTGGGGAGAAAATGGATATTGCAGAATCGCCACTCAACAA GATGGTTTGCCCAAGAAAGTGGATTGGGTTGAGAGCGCTGTTGTTACTCCGCCAAGAGATCAAGGACCCTCTCCAACTTGTTGGGCATATAGTGGAGTAGCAGCAATAGAATCGATGAATAAAATAAAAAGAGGGCAATTAGTTAACCTGACCGTTGTTGATGTTATTATTGACAACATACGGTTTTGGATGGATGGAGCATGGCCGGACGTTGGTATAGTAAAGACTACTTGCTGCTCAAAAACTCATGGGGATGTATCTGGGGAGAAAATGGATATTGCAGAATCGCCACTCAACAA DGLPKKVDWVESAVVTPPRDQGPSPTCWAYSGVAAIESMNKIKRGQLVNLTVVDVIIDNIRFWMDGAWPDVGIVKTTCCSKTHGDVSGEKMDIAESPLNX
BLAST of CsaV3_3G010970 vs. NCBI nr
Match: KGN56737.1 (hypothetical protein Csa_3G131900 [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 2.4e-32 Identity = 69/71 (97.18%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. NCBI nr
Match: XP_011652750.1 (PREDICTED: ananain-like [Cucumis sativus]) HSP 1 Score: 147.5 bits (371), Expect = 2.4e-32 Identity = 69/71 (97.18%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. NCBI nr
Match: XP_018824181.1 (PREDICTED: ervatamin-B-like [Juglans regia]) HSP 1 Score: 68.6 bits (166), Expect = 1.4e-08 Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. NCBI nr
Match: XP_012079031.1 (ervatamin-B [Jatropha curcas]) HSP 1 Score: 66.2 bits (160), Expect = 7.0e-08 Identity = 27/54 (50.00%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. NCBI nr
Match: KDO45769.1 (hypothetical protein CISIN_1g041120mg [Citrus sinensis]) HSP 1 Score: 65.5 bits (158), Expect = 1.2e-07 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TAIR10
Match: AT4G11310.1 (Papain family cysteine protease) HSP 1 Score: 60.8 bits (146), Expect = 5.4e-10 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TAIR10
Match: AT1G06260.1 (Cysteine proteinases superfamily protein) HSP 1 Score: 60.5 bits (145), Expect = 7.0e-10 Identity = 35/88 (39.77%), Postives = 51/88 (57.95%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TAIR10
Match: AT4G11320.1 (Papain family cysteine protease) HSP 1 Score: 60.5 bits (145), Expect = 7.0e-10 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TAIR10
Match: AT3G19390.1 (Granulin repeat cysteine protease family protein) HSP 1 Score: 59.3 bits (142), Expect = 1.6e-09 Identity = 22/56 (39.29%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TAIR10
Match: AT4G23520.1 (Cysteine proteinases superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 1.6e-09 Identity = 25/60 (41.67%), Postives = 41/60 (68.33%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. Swiss-Prot
Match: sp|P80884|ANAN_ANACO (Ananain OS=Ananas comosus OX=4615 GN=AN1 PE=1 SV=2) HSP 1 Score: 61.6 bits (148), Expect = 5.7e-09 Identity = 25/66 (37.88%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. Swiss-Prot
Match: sp|Q9SUT0|RDL4_ARATH (Probable cysteine protease RDL4 OS=Arabidopsis thaliana OX=3702 GN=RDL4 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 9.7e-09 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. Swiss-Prot
Match: sp|Q9SUS9|RDL5_ARATH (Probable cysteine protease RDL5 OS=Arabidopsis thaliana OX=3702 GN=RDL5 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. Swiss-Prot
Match: sp|P10056|PAPA3_CARPA (Caricain OS=Carica papaya OX=3649 PE=1 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 1.6e-08 Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. Swiss-Prot
Match: sp|Q9LT78|RD21C_ARATH (Probable cysteine protease RD21C OS=Arabidopsis thaliana OX=3702 GN=RD21C PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.8e-08 Identity = 22/56 (39.29%), Postives = 37/56 (66.07%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TrEMBL
Match: tr|A0A0A0L7Y4|A0A0A0L7Y4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G131900 PE=3 SV=1) HSP 1 Score: 147.5 bits (371), Expect = 1.6e-32 Identity = 69/71 (97.18%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TrEMBL
Match: tr|A0A2I4EXQ7|A0A2I4EXQ7_9ROSI (ervatamin-B-like OS=Juglans regia OX=51240 GN=LOC108993649 PE=3 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 9.4e-09 Identity = 29/64 (45.31%), Postives = 44/64 (68.75%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TrEMBL
Match: tr|A0A1D1YSU4|A0A1D1YSU4_9ARAE (Cysteine proteinase RD21a (Fragment) OS=Anthurium amnicola OX=1678845 GN=RD21A_6 PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 2.1e-08 Identity = 30/72 (41.67%), Postives = 46/72 (63.89%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TrEMBL
Match: tr|A0A2N9IKF6|A0A2N9IKF6_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS52502 PE=3 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 6.1e-08 Identity = 31/65 (47.69%), Postives = 43/65 (66.15%), Query Frame = 0
BLAST of CsaV3_3G010970 vs. TrEMBL
Match: tr|A0A2H5QQA3|A0A2H5QQA3_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_251670 PE=3 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 7.9e-08 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |