CsaV3_1G015240 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA ATGCGGGGATTAGGGGCTGCATGGAAGGTGTTTGATGGAATGCACGATAGGAATGAGGTGTTGCGATCGGTTTTGATTGGGAGATTGGGGCAAGTGGAAGAAGAAGAGAAGTTGATAATGGAGATGGAGGTCGAGCCTGATAAGGGTTTGTGGGGTGCCATGTTGAGTGCTTGTAGGATTCATGGGAAGGCCGACGTTGCTGATAGGGTTCAAAAACGGTTTATGAAACAACAATGA MRGLGAAWKVFDGMHDRNEVLRSVLIGRLGQVEEEEKLIMEMEVEPDKGLWGAMLSACRIHGKADVADRVQKRFMKQQ
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: KGN64972.1 (hypothetical protein Csa_1G169960 [Cucumis sativus]) HSP 1 Score: 161.8 bits (408), Expect = 9.7e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_008455480.1 (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis melo]) HSP 1 Score: 99.4 bits (246), Expect = 5.9e-18 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_004144516.1 (PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucumis sativus] >KGN43485.1 hypothetical protein Csa_7G041310 [Cucumis sativus]) HSP 1 Score: 99.0 bits (245), Expect = 7.7e-18 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_022927399.1 (pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 94.7 bits (234), Expect = 1.5e-16 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. NCBI nr
Match: XP_023520705.1 (pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 94.7 bits (234), Expect = 1.5e-16 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR10
Match: AT1G15510.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 55.1 bits (131), Expect = 2.3e-08 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR10
Match: AT3G46790.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 53.9 bits (128), Expect = 5.2e-08 Identity = 19/49 (38.78%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR10
Match: AT4G01030.1 (pentatricopeptide (PPR) repeat-containing protein) HSP 1 Score: 53.9 bits (128), Expect = 5.2e-08 Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR10
Match: AT4G33990.1 (Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TAIR10
Match: AT5G44230.1 (Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 6.8e-08 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. Swiss-Prot
Match: sp|Q9M9E2|PPR45_ARATH (Pentatricopeptide repeat-containing protein At1g15510, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H73 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.2e-07 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. Swiss-Prot
Match: sp|Q9STF3|PP265_ARATH (Pentatricopeptide repeat-containing protein At3g46790, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRR2 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 9.3e-07 Identity = 19/49 (38.78%), Postives = 34/49 (69.39%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. Swiss-Prot
Match: sp|Q9SV26|PP297_ARATH (Pentatricopeptide repeat-containing protein At4g01030, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PCMP-H65 PE=3 SV=2) HSP 1 Score: 53.9 bits (128), Expect = 9.3e-07 Identity = 26/74 (35.14%), Postives = 41/74 (55.41%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. Swiss-Prot
Match: sp|O81767|PP348_ARATH (Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana OX=3702 GN=EMB2758 PE=3 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 21/42 (50.00%), Postives = 29/42 (69.05%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. Swiss-Prot
Match: sp|Q9FFG8|PP417_ARATH (Pentatricopeptide repeat-containing protein At5g44230 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H17 PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 22/44 (50.00%), Postives = 32/44 (72.73%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TrEMBL
Match: tr|A0A0A0LVX2|A0A0A0LVX2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G169960 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 6.4e-37 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TrEMBL
Match: tr|A0A1S3C0K0|A0A1S3C0K0_CUCME (pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103495634 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.9e-18 Identity = 46/54 (85.19%), Postives = 51/54 (94.44%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TrEMBL
Match: tr|A0A0A0K1F7|A0A0A0K1F7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G041310 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 5.1e-18 Identity = 46/54 (85.19%), Postives = 50/54 (92.59%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TrEMBL
Match: tr|A0A2I4GR45|A0A2I4GR45_9ROSI (pentatricopeptide repeat-containing protein At4g16470-like OS=Juglans regia OX=51240 GN=LOC109010111 PE=4 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.5e-12 Identity = 34/54 (62.96%), Postives = 46/54 (85.19%), Query Frame = 0
BLAST of CsaV3_1G015240 vs. TrEMBL
Match: tr|A0A2P4HV05|A0A2P4HV05_QUESU (Putative pentatricopeptide repeat-containing protein OS=Quercus suber OX=58331 GN=CFP56_03617 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 4.6e-11 Identity = 32/50 (64.00%), Postives = 43/50 (86.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|