CsaV3_1G012010 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGATTTTTCGACCGCAGGACGAGATCCATTGTTTTACGCTCATCACGTGAATGTCGATGGCATGTGGAAGATTTGGAAAGAAATGGGGAATCAAGATCACACCGACGAGGGTTGGGTAAACTCGACATTTGTGTTTTACGATGAGAATCAAAACGCTGTACGTATCAAAGTTTCGGATTGTTTGGACAGTAAGAAACTTGGGTATGATTATGAAAAGGTACCCATTTCATGGAAGCATTTGAAGAAAACCCCGTTACCAAATAATAATTGTATAATTAATAGAGAATTATTCCAGCTGCCTCCAATGAAGCAAAGTTTCCTGTGAAGATGAAACCTAAGCTTGGTGGAGAAAGCGTCAGTATTGGAGGGATAACGGCTCAGCTTCAGCCTGTGTAA ATGGGAGATTTTTCGACCGCAGGACGAGATCCATTGTTTTACGCTCATCACGTGAATGTCGATGGCATGTGGAAGATTTGGAAAGAAATGGGGAATCAAGATCACACCGACGAGGGTTGGGTAAACTCGACATTTGTGTTTTACGATGAGAATCAAAACGCTGTACGTATCAAAGTTTCGGATTGTTTGGACAGTAAGAAACTTGGGTATGATTATGAAAAGAGAATTATTCCAGCTGCCTCCAATGAAGCAAAGTTTCCTGTGAAGATGAAACCTAAGCTTGGTGGAGAAAGCGTCAGTATTGGAGGGATAACGGCTCAGCTTCAGCCTGTGTAA ATGGGAGATTTTTCGACCGCAGGACGAGATCCATTGTTTTACGCTCATCACGTGAATGTCGATGGCATGTGGAAGATTTGGAAAGAAATGGGGAATCAAGATCACACCGACGAGGGTTGGGTAAACTCGACATTTGTGTTTTACGATGAGAATCAAAACGCTGTACGTATCAAAGTTTCGGATTGTTTGGACAGTAAGAAACTTGGGTATGATTATGAAAAGAGAATTATTCCAGCTGCCTCCAATGAAGCAAAGTTTCCTGTGAAGATGAAACCTAAGCTTGGTGGAGAAAGCGTCAGTATTGGAGGGATAACGGCTCAGCTTCAGCCTGTGTAA MGDFSTAGRDPLFYAHHVNVDGMWKIWKEMGNQDHTDEGWVNSTFVFYDENQNAVRIKVSDCLDSKKLGYDYEKRIIPAASNEAKFPVKMKPKLGGESVSIGGITAQLQPV
BLAST of CsaV3_1G012010 vs. NCBI nr
Match: XP_011648445.1 (PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]) HSP 1 Score: 238.8 bits (608), Expect = 8.9e-60 Identity = 111/111 (100.00%), Postives = 111/111 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. NCBI nr
Match: KGN64650.1 (hypothetical protein Csa_1G073100 [Cucumis sativus]) HSP 1 Score: 224.6 bits (571), Expect = 1.7e-55 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. NCBI nr
Match: XP_017978714.1 (PREDICTED: polyphenol oxidase, chloroplastic [Theobroma cacao]) HSP 1 Score: 118.6 bits (296), Expect = 1.3e-23 Identity = 50/80 (62.50%), Postives = 63/80 (78.75%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. NCBI nr
Match: XP_021294109.1 (polyphenol oxidase, chloroplastic-like [Herrania umbratica]) HSP 1 Score: 118.6 bits (296), Expect = 1.3e-23 Identity = 50/80 (62.50%), Postives = 64/80 (80.00%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. NCBI nr
Match: XP_015956318.1 (polyphenol oxidase A1, chloroplastic [Arachis duranensis] >XP_025690059.1 polyphenol oxidase A1, chloroplastic-like [Arachis hypogaea]) HSP 1 Score: 117.1 bits (292), Expect = 3.9e-23 Identity = 51/85 (60.00%), Postives = 61/85 (71.76%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. Swiss-Prot
Match: sp|P43311|PPO_VITVI (Polyphenol oxidase, chloroplastic OS=Vitis vinifera OX=29760 PE=1 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.2e-23 Identity = 50/103 (48.54%), Postives = 65/103 (63.11%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. Swiss-Prot
Match: sp|Q9MB14|PPO2_IPOBA (Polyphenol oxidase II, chloroplastic OS=Ipomoea batatas OX=4120 GN=co-2 PE=2 SV=2) HSP 1 Score: 109.0 bits (271), Expect = 3.5e-23 Identity = 51/102 (50.00%), Postives = 67/102 (65.69%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. Swiss-Prot
Match: sp|Q9ZP19|PPO1_IPOBA (Polyphenol oxidase I, chloroplastic OS=Ipomoea batatas OX=4120 GN=co-1 PE=1 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.7e-22 Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. Swiss-Prot
Match: sp|Q08307|PPOE_SOLLC (Polyphenol oxidase E, chloroplastic OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.2e-22 Identity = 45/74 (60.81%), Postives = 56/74 (75.68%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. Swiss-Prot
Match: sp|P43309|PPO_MALDO (Polyphenol oxidase, chloroplastic OS=Malus domestica OX=3750 PE=2 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.5e-22 Identity = 46/85 (54.12%), Postives = 62/85 (72.94%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. TrEMBL
Match: tr|A0A0A0LRV2|A0A0A0LRV2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G073100 PE=4 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 1.1e-55 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. TrEMBL
Match: tr|A0A061GMJ6|A0A061GMJ6_THECC (Uncharacterized protein OS=Theobroma cacao OX=3641 GN=TCM_029922 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 3.4e-23 Identity = 49/80 (61.25%), Postives = 63/80 (78.75%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. TrEMBL
Match: tr|A0A1U8HXV2|A0A1U8HXV2_GOSHI (polyphenol oxidase, chloroplastic-like OS=Gossypium hirsutum OX=3635 GN=LOC107888998 PE=4 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 5.7e-23 Identity = 49/80 (61.25%), Postives = 62/80 (77.50%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. TrEMBL
Match: tr|A0A2P5CT50|A0A2P5CT50_9ROSA (Polyphenol oxidase OS=Trema orientalis OX=63057 GN=TorRG33x02_273860 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 7.5e-23 Identity = 49/80 (61.25%), Postives = 61/80 (76.25%), Query Frame = 0
BLAST of CsaV3_1G012010 vs. TrEMBL
Match: tr|A0A1S3BFJ5|A0A1S3BFJ5_CUCME (polyphenol oxidase I, chloroplastic-like OS=Cucumis melo OX=3656 GN=LOC103489300 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 9.8e-23 Identity = 51/80 (63.75%), Postives = 65/80 (81.25%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |