CsaV3_1G011430 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.GATGAGAAACAAATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA GATGAGAAACAAATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA GATGAGAAACAAATGGGGCGCGACGGATCCTATGCAGAATACTACATGAAGGAGCATCCAGGCATTTCCTATGAAGCAACACAGCAACATATTCAGAAGAAGATTTCTGAAGCATGGAAGACTCTGAATACAGAACATCTCTTTTCTAATATCTTCCCCACCAGTTTCACTCAGGCTTCTCTCAATATTGCTAGAGCTGTTCCTTTGGCGTATAACTATGGTAGAAACCAATCTATCATGACAGTCGAGAAGCTTATGGAACAATATTGCTAA DEKQMGRDGSYAEYYMKEHPGISYEATQQHIQKKISEAWKTLNTEHLFSNIFPTSFTQASLNIARAVPLAYNYGRNQSIMTVEKLMEQYC
BLAST of CsaV3_1G011430 vs. NCBI nr
Match: KGN64590.1 (hypothetical protein Csa_1G070070 [Cucumis sativus]) HSP 1 Score: 179.1 bits (453), Expect = 6.8e-42 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. NCBI nr
Match: XP_016903707.1 (PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]) HSP 1 Score: 179.1 bits (453), Expect = 6.8e-42 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. NCBI nr
Match: XP_022140154.1 ((3S,6E)-nerolidol synthase 1-like [Momordica charantia]) HSP 1 Score: 137.1 bits (344), Expect = 2.9e-29 Identity = 64/87 (73.56%), Postives = 74/87 (85.06%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. NCBI nr
Match: XP_022941968.1 ((3S,6E)-nerolidol synthase 1-like [Cucurbita moschata]) HSP 1 Score: 136.7 bits (343), Expect = 3.9e-29 Identity = 64/88 (72.73%), Postives = 74/88 (84.09%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. NCBI nr
Match: XP_022986721.1 ((3S,6E)-nerolidol synthase 1-like [Cucurbita maxima]) HSP 1 Score: 136.3 bits (342), Expect = 5.0e-29 Identity = 63/88 (71.59%), Postives = 74/88 (84.09%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TAIR10
Match: AT1G61680.1 (terpene synthase 14) HSP 1 Score: 74.7 bits (182), Expect = 3.3e-14 Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TAIR10
Match: AT5G23960.1 (terpene synthase 21) HSP 1 Score: 40.4 bits (93), Expect = 6.8e-04 Identity = 23/75 (30.67%), Postives = 41/75 (54.67%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. Swiss-Prot
Match: sp|P0CV96|NES1_FRAVE ((3S,6E)-nerolidol synthase 1, chloroplastic OS=Fragaria vesca OX=57918 PE=1 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 5.7e-16 Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. Swiss-Prot
Match: sp|P0CV94|NES1_FRAAN ((3S,6E)-nerolidol synthase 1 OS=Fragaria ananassa OX=3747 PE=1 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.7e-15 Identity = 41/87 (47.13%), Postives = 55/87 (63.22%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. Swiss-Prot
Match: sp|P0CV95|NES2_FRAAN ((3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial OS=Fragaria ananassa OX=3747 PE=1 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-14 Identity = 39/87 (44.83%), Postives = 54/87 (62.07%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. Swiss-Prot
Match: sp|B9RXW4|TPS13_RICCO (Probable terpene synthase 13 OS=Ricinus communis OX=3988 GN=TPS13 PE=3 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-13 Identity = 39/83 (46.99%), Postives = 50/83 (60.24%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. Swiss-Prot
Match: sp|Q84UV0|LINS_ARATH (S-(+)-linalool synthase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TPS14 PE=2 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 5.9e-13 Identity = 38/79 (48.10%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TrEMBL
Match: tr|A0A1S4E662|A0A1S4E662_CUCME ((3S,6E)-nerolidol synthase 1-like OS=Cucumis melo OX=3656 GN=LOC103489227 PE=3 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 4.5e-42 Identity = 87/90 (96.67%), Postives = 88/90 (97.78%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TrEMBL
Match: tr|A0A0A0LRQ7|A0A0A0LRQ7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G070070 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 4.5e-42 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TrEMBL
Match: tr|A0A0A0LUC8|A0A0A0LUC8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G068570 PE=3 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 1.2e-26 Identity = 60/87 (68.97%), Postives = 71/87 (81.61%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TrEMBL
Match: tr|A0A1S3B3I5|A0A1S3B3I5_CUCME ((3S,6E)-nerolidol synthase 1-like OS=Cucumis melo OX=3656 GN=LOC103485759 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.5e-26 Identity = 61/88 (69.32%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CsaV3_1G011430 vs. TrEMBL
Match: tr|A0A1R3JTH4|A0A1R3JTH4_9ROSI (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_14081 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 2.2e-17 Identity = 47/87 (54.02%), Postives = 61/87 (70.11%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |