CsaV3_1G009390 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGG ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGG ATGTTTAGTTTCACAAGTTGGTGCAATTTTCCACTTTATGAAACAGATTTTGGTTGGGGAAAACCAACGTGGGCCTGTACTCCTGGGCGGCGGTACAAGAACGTGGTGCTTTTTGTTAACACTAGCGACGGTAAAGGAATCGAAGCATGG MFSFTSWCNFPLYETDFGWGKPTWACTPGRRYKNVVLFVNTSDGKGIEAW
BLAST of CsaV3_1G009390 vs. NCBI nr
Match: KGN64383.1 (hypothetical protein Csa_1G050220 [Cucumis sativus]) HSP 1 Score: 120.9 bits (302), Expect = 1.2e-24 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. NCBI nr
Match: XP_008446186.1 (PREDICTED: vinorine synthase-like [Cucumis melo] >ADN33961.1 anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]) HSP 1 Score: 109.4 bits (272), Expect = 3.6e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. NCBI nr
Match: KGN64382.1 (hypothetical protein Csa_1G050210 [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 4.7e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. NCBI nr
Match: XP_011660357.1 (PREDICTED: LOW QUALITY PROTEIN: vinorine synthase-like [Cucumis sativus]) HSP 1 Score: 109.0 bits (271), Expect = 4.7e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. NCBI nr
Match: XP_022923632.1 (vinorine synthase-like [Cucurbita moschata]) HSP 1 Score: 105.9 bits (263), Expect = 4.0e-20 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TAIR10
Match: AT1G24430.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 77.8 bits (190), Expect = 2.1e-15 Identity = 30/49 (61.22%), Postives = 36/49 (73.47%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TAIR10
Match: AT3G26040.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 67.4 bits (163), Expect = 2.9e-12 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TAIR10
Match: AT1G24420.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 66.2 bits (160), Expect = 6.4e-12 Identity = 25/46 (54.35%), Postives = 32/46 (69.57%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TAIR10
Match: AT5G47950.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 58.9 bits (141), Expect = 1.0e-09 Identity = 24/51 (47.06%), Postives = 31/51 (60.78%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TAIR10
Match: AT3G30280.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 57.4 bits (137), Expect = 3.0e-09 Identity = 22/50 (44.00%), Postives = 32/50 (64.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. Swiss-Prot
Match: sp|Q70PR7|VINSY_RAUSE (Vinorine synthase OS=Rauvolfia serpentina OX=4060 GN=ACT PE=1 SV=2) HSP 1 Score: 64.7 bits (156), Expect = 3.3e-10 Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. Swiss-Prot
Match: sp|Q6TXD2|5MAT2_SALSN (Pelargonidin 3-O-(6-caffeoylglucoside) 5-O-(6-O-malonylglucoside) 4'''-malonyltransferase OS=Salvia splendens OX=180675 PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 7.0e-08 Identity = 23/49 (46.94%), Postives = 29/49 (59.18%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. Swiss-Prot
Match: sp|Q9ZTK5|DAT_CATRO (Deacetylvindoline O-acetyltransferase OS=Catharanthus roseus OX=4058 GN=DAT PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.6e-07 Identity = 23/46 (50.00%), Postives = 27/46 (58.70%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. Swiss-Prot
Match: sp|Q94FT4|SALAT_PAPSO (Salutaridinol 7-O-acetyltransferase OS=Papaver somniferum OX=3469 GN=SALAT PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.0e-06 Identity = 23/51 (45.10%), Postives = 27/51 (52.94%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. Swiss-Prot
Match: sp|Q9FI40|BAHD1_ARATH (BAHD acyltransferase At5g47980 OS=Arabidopsis thaliana OX=3702 GN=BAHD1 PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-06 Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TrEMBL
Match: tr|A0A0A0LRG4|A0A0A0LRG4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050220 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.0e-25 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TrEMBL
Match: tr|A0A1S3BF49|A0A1S3BF49_CUCME (vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103488987 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TrEMBL
Match: tr|E5GBW2|E5GBW2_CUCME (Anthranilate N-benzoyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TrEMBL
Match: tr|A0A0A0LUA9|A0A0A0LUA9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050210 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.1e-21 Identity = 44/50 (88.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of CsaV3_1G009390 vs. TrEMBL
Match: tr|A0A1S3AYP7|A0A1S3AYP7_CUCME (LOW QUALITY PROTEIN: vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103484210 PE=4 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 7.7e-20 Identity = 42/50 (84.00%), Postives = 44/50 (88.00%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |