CsaV3_1G009370 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTAA AATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTA AATCAATCAATGGAGATGAACAATAGTCTCAAGATAGATCTAATCTCAACAGAGATAATAAAGCCTTCATCTCCAACACCTTCAACCCACCAACACCACAAACTTTCATTTCTTGACCAACCTGCCCCAGGCAGCTACACTCCTCTCCTCTTCTTCTACCCTGGTGGCGGCGACCACCGCGACCGGTGTCGGAAATTGAAGGAATCTCTCGCTTA NQSMEMNNSLKIDLISTEIIKPSSPTPSTHQHHKLSFLDQPAPGSYTPLLFFYPGGGDHRDRCRKLKESLAX
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: XP_011660357.1 (PREDICTED: LOW QUALITY PROTEIN: vinorine synthase-like [Cucumis sativus]) HSP 1 Score: 151.0 bits (380), Expect = 1.6e-33 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: KGN64382.1 (hypothetical protein Csa_1G050210 [Cucumis sativus]) HSP 1 Score: 131.3 bits (329), Expect = 1.3e-27 Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: XP_008446186.1 (PREDICTED: vinorine synthase-like [Cucumis melo] >ADN33961.1 anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]) HSP 1 Score: 129.4 bits (324), Expect = 4.9e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: ADN33960.1 (anthranilate N-benzoyltransferase [Cucumis melo subsp. melo]) HSP 1 Score: 127.5 bits (319), Expect = 1.8e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. NCBI nr
Match: XP_008439406.1 (PREDICTED: vinorine synthase-like [Cucumis melo]) HSP 1 Score: 127.5 bits (319), Expect = 1.8e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR10
Match: AT3G26040.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 53.5 bits (127), Expect = 6.2e-08 Identity = 25/64 (39.06%), Postives = 43/64 (67.19%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR10
Match: AT4G15390.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 46.2 bits (108), Expect = 9.8e-06 Identity = 27/65 (41.54%), Postives = 34/65 (52.31%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR10
Match: AT1G24430.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 45.8 bits (107), Expect = 1.3e-05 Identity = 29/66 (43.94%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR10
Match: AT5G23970.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 43.5 bits (101), Expect = 6.4e-05 Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TAIR10
Match: AT1G24420.1 (HXXXD-type acyl-transferase family protein) HSP 1 Score: 42.4 bits (98), Expect = 1.4e-04 Identity = 25/66 (37.88%), Postives = 35/66 (53.03%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. Swiss-Prot
Match: sp|Q94FT4|SALAT_PAPSO (Salutaridinol 7-O-acetyltransferase OS=Papaver somniferum OX=3469 GN=SALAT PE=1 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 9.4e-06 Identity = 29/71 (40.85%), Postives = 40/71 (56.34%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TrEMBL
Match: tr|A0A0A0LUA9|A0A0A0LUA9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G050210 PE=4 SV=1) HSP 1 Score: 131.3 bits (329), Expect = 8.5e-28 Identity = 63/69 (91.30%), Postives = 66/69 (95.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TrEMBL
Match: tr|A0A1S3BF49|A0A1S3BF49_CUCME (vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103488987 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.2e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TrEMBL
Match: tr|E5GBW2|E5GBW2_CUCME (Anthranilate N-benzoyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.2e-27 Identity = 61/68 (89.71%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TrEMBL
Match: tr|A0A1S3AYN5|A0A1S3AYN5_CUCME (vinorine synthase-like OS=Cucumis melo OX=3656 GN=LOC103484219 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.2e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
BLAST of CsaV3_1G009370 vs. TrEMBL
Match: tr|E5GBW1|E5GBW1_CUCME (Anthranilate N-benzoyltransferase OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.2e-26 Identity = 61/69 (88.41%), Postives = 64/69 (92.75%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |