CsaV3_1G003190 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG ATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG ATGACAGTTGTATGGAAAGAGTTCTTGCAATGGAACTCTCCCATCCCATATATCTTTGGAGGCCTTGCTGTTGTTTTCGGAATCACTTCTGCCGTTCTTTTTATCCTTGCTTGCTCTCACCAAATATGGATGCGAAATTCTATCAACAACGACAAAGAGAAAGCAAGCAAAAACAAAGGAAGCGAGCAATTTGATACTACTCCAAGTATAGCTGTAATCATGGCTGGAGATGATCATCCCAAGTACATGGCAAAGCCTGTCTCTTTTGTTAAGAATTAG MTVVWKEFLQWNSPIPYIFGGLAVVFGITSAVLFILACSHQIWMRNSINNDKEKASKNKGSEQFDTTPSIAVIMAGDDHPKYMAKPVSFVKN
BLAST of CsaV3_1G003190 vs. NCBI nr
Match: KGN63754.1 (hypothetical protein Csa_1G014510 [Cucumis sativus]) HSP 1 Score: 192.6 bits (488), Expect = 6.0e-46 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. NCBI nr
Match: KJB19453.1 (hypothetical protein B456_003G104400 [Gossypium raimondii]) HSP 1 Score: 84.0 bits (206), Expect = 3.0e-13 Identity = 43/87 (49.43%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. NCBI nr
Match: XP_022759922.1 (protein GLUTAMINE DUMPER 2-like [Durio zibethinus]) HSP 1 Score: 84.0 bits (206), Expect = 3.0e-13 Identity = 39/82 (47.56%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. NCBI nr
Match: XP_022755818.1 (protein GLUTAMINE DUMPER 4-like [Durio zibethinus]) HSP 1 Score: 83.6 bits (205), Expect = 4.0e-13 Identity = 42/80 (52.50%), Postives = 51/80 (63.75%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. NCBI nr
Match: XP_023903787.1 (protein GLUTAMINE DUMPER 4-like [Quercus suber] >POF20274.1 protein glutamine dumper 4 [Quercus suber]) HSP 1 Score: 83.2 bits (204), Expect = 5.2e-13 Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TAIR10
Match: AT2G24762.1 (glutamine dumper 4) HSP 1 Score: 61.6 bits (148), Expect = 2.9e-10 Identity = 34/85 (40.00%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TAIR10
Match: AT4G31730.1 (glutamine dumper 1) HSP 1 Score: 61.2 bits (147), Expect = 3.8e-10 Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TAIR10
Match: AT5G24920.1 (glutamine dumper 5) HSP 1 Score: 59.3 bits (142), Expect = 1.4e-09 Identity = 30/79 (37.97%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TAIR10
Match: AT5G57685.1 (glutamine dumper 3) HSP 1 Score: 58.2 bits (139), Expect = 3.2e-09 Identity = 32/88 (36.36%), Postives = 46/88 (52.27%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TAIR10
Match: AT4G25760.1 (glutamine dumper 2) HSP 1 Score: 55.5 bits (132), Expect = 2.1e-08 Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. Swiss-Prot
Match: sp|Q8S8A0|GDU4_ARATH (Protein GLUTAMINE DUMPER 4 OS=Arabidopsis thaliana OX=3702 GN=GDU4 PE=2 SV=1) HSP 1 Score: 61.6 bits (148), Expect = 5.3e-09 Identity = 34/85 (40.00%), Postives = 50/85 (58.82%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. Swiss-Prot
Match: sp|O81775|GDU1_ARATH (Protein GLUTAMINE DUMPER 1 OS=Arabidopsis thaliana OX=3702 GN=GDU1 PE=1 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.9e-09 Identity = 34/83 (40.96%), Postives = 49/83 (59.04%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. Swiss-Prot
Match: sp|Q3E965|GDU5_ARATH (Protein GLUTAMINE DUMPER 5 OS=Arabidopsis thaliana OX=3702 GN=GDU5 PE=2 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 2.6e-08 Identity = 30/79 (37.97%), Postives = 50/79 (63.29%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. Swiss-Prot
Match: sp|Q9FHH5|GDU3_ARATH (Protein GLUTAMINE DUMPER 3 OS=Arabidopsis thaliana OX=3702 GN=GDU3 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.8e-08 Identity = 32/88 (36.36%), Postives = 46/88 (52.27%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. Swiss-Prot
Match: sp|Q9SW07|GDU2_ARATH (Protein GLUTAMINE DUMPER 2 OS=Arabidopsis thaliana OX=3702 GN=GDU2 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.8e-07 Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TrEMBL
Match: tr|A0A0A0LRW3|A0A0A0LRW3_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G014510 PE=4 SV=1) HSP 1 Score: 192.6 bits (488), Expect = 4.0e-46 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TrEMBL
Match: tr|A0A2N9FM01|A0A2N9FM01_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS16120 PE=4 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 1.2e-13 Identity = 41/81 (50.62%), Postives = 56/81 (69.14%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TrEMBL
Match: tr|A0A0D2NZ67|A0A0D2NZ67_GOSRA (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_003G104400 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 43/87 (49.43%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TrEMBL
Match: tr|A0A2P4MS21|A0A2P4MS21_QUESU (Protein glutamine dumper 4 OS=Quercus suber OX=58331 GN=CFP56_49190 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 3.4e-13 Identity = 40/81 (49.38%), Postives = 57/81 (70.37%), Query Frame = 0
BLAST of CsaV3_1G003190 vs. TrEMBL
Match: tr|A0A2P5RXD9|A0A2P5RXD9_GOSBA (Uncharacterized protein OS=Gossypium barbadense OX=3634 GN=GOBAR_DD11588 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 3.4e-13 Identity = 42/87 (48.28%), Postives = 53/87 (60.92%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |