CsaV3_1G002040 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGCATAGGCTATATCATAATTGCTTCAGGCTTCACTGGGAATTTATACATAGGATCAGTGACTGTAGGAATCTGCTATGGAGCTCAAAACTCACTAATGCCTGCAGCAGTTACATCAGAGATATTTGGGATAAAGCATATGGACACCATTTACAACACCATTAATGTAGCATATCCCGATGGATCTTAG ATGGGCATAGGCTATATCATAATTGCTTCAGGCTTCACTGGGAATTTATACATAGGATCAGTGACTGTAGGAATCTGCTATGGAGCTCAAAACTCACTAATGCCTGCAGCAGTTACATCAGAGATATTTGGGATAAAGCATATGGACACCATTTACAACACCATTAATGTAGCATATCCCGATGGATCTTAG ATGGGCATAGGCTATATCATAATTGCTTCAGGCTTCACTGGGAATTTATACATAGGATCAGTGACTGTAGGAATCTGCTATGGAGCTCAAAACTCACTAATGCCTGCAGCAGTTACATCAGAGATATTTGGGATAAAGCATATGGACACCATTTACAACACCATTAATGTAGCATATCCCGATGGATCTTAG MGIGYIIIASGFTGNLYIGSVTVGICYGAQNSLMPAAVTSEIFGIKHMDTIYNTINVAYPDGS
BLAST of CsaV3_1G002040 vs. NCBI nr
Match: KGN63640.1 (hypothetical protein Csa_1G008465 [Cucumis sativus]) HSP 1 Score: 129.0 bits (323), Expect = 5.6e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. NCBI nr
Match: XP_022933362.1 (uncharacterized protein LOC111440723 [Cucurbita moschata]) HSP 1 Score: 94.0 bits (232), Expect = 2.0e-16 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. NCBI nr
Match: XP_018481036.1 (PREDICTED: uncharacterized protein LOC108852043 [Raphanus sativus]) HSP 1 Score: 92.0 bits (227), Expect = 7.7e-16 Identity = 45/63 (71.43%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. NCBI nr
Match: XP_022973074.1 (uncharacterized protein LOC111471579 [Cucurbita maxima]) HSP 1 Score: 91.3 bits (225), Expect = 1.3e-15 Identity = 45/63 (71.43%), Postives = 55/63 (87.30%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. NCBI nr
Match: XP_010539949.1 (PREDICTED: protein NUCLEAR FUSION DEFECTIVE 4-like [Tarenaya hassleriana]) HSP 1 Score: 90.9 bits (224), Expect = 1.7e-15 Identity = 45/63 (71.43%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TAIR10
Match: AT1G74780.1 (Nodulin-like / Major Facilitator Superfamily protein) HSP 1 Score: 90.5 bits (223), Expect = 4.0e-19 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TAIR10
Match: AT1G18940.1 (Nodulin-like / Major Facilitator Superfamily protein) HSP 1 Score: 89.4 bits (220), Expect = 9.0e-19 Identity = 44/63 (69.84%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TAIR10
Match: AT2G34355.1 (Major facilitator superfamily protein) HSP 1 Score: 78.2 bits (191), Expect = 2.1e-15 Identity = 40/63 (63.49%), Postives = 50/63 (79.37%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TAIR10
Match: AT2G34350.1 (Nodulin-like / Major Facilitator Superfamily protein) HSP 1 Score: 76.3 bits (186), Expect = 7.9e-15 Identity = 38/63 (60.32%), Postives = 50/63 (79.37%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TAIR10
Match: AT2G39210.1 (Major facilitator superfamily protein) HSP 1 Score: 57.4 bits (137), Expect = 3.8e-09 Identity = 29/60 (48.33%), Postives = 41/60 (68.33%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TrEMBL
Match: tr|A0A0A0LP14|A0A0A0LP14_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G008465 PE=4 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.7e-27 Identity = 63/63 (100.00%), Postives = 63/63 (100.00%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TrEMBL
Match: tr|Q84R22|Q84R22_ARATH (Uncharacterized protein At1g74780 OS=Arabidopsis thaliana OX=3702 GN=At1g74780 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-15 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TrEMBL
Match: tr|Q9SSG2|Q9SSG2_ARATH (F25A4.25 protein OS=Arabidopsis thaliana OX=3702 GN=At1g74780 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-15 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TrEMBL
Match: tr|A0A178WDE9|A0A178WDE9_ARATH (Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At1g69160 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.5e-15 Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 0
BLAST of CsaV3_1G002040 vs. TrEMBL
Match: tr|A0A2P4N3H3|A0A2P4N3H3_QUESU (Protein nuclear fusion defective 4 OS=Quercus suber OX=58331 GN=CFP56_27534 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 2.5e-15 Identity = 43/63 (68.25%), Postives = 53/63 (84.13%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |