CsaUNG008830 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGAGTTAACCATAGAAACTTGAACAGTCTTGTTGGATATTTGAATGAAGAAAACCATATTGGCCTCATTTACGAGTACATGGCAAATGGAGATTTGGCCGAACATCTTTCAGGTAAACCCAATGGTGATAAGTTTCACATTATTACTTAGAAGATTAGTCTAAATTTGAATGTAATTGATGAGTTTTAAGAGTTTAATTCTTGTTTTATGTATTGAAATCATCTCTAGCAATGGAAACTATGAATCCAGTGTTTACTTTTGTTGTTAAGAGTACCTCTTATCTTTTGGTTTGATTCAAGGATAAGCTTCAGATGTATAGAAATTAATGATGATACATGATACATGATACATGATCTTGCTCTTACCTTCTTATCTTTTGGTTTGATTCAAGGCTGTTGTAGTCTATATTTTGTGAAAAACTGGCATTTCTTTCAAACTTTCATACAAATATTTGTTTTAAATCACTTCTGTAGACTGGAGAATATGAAGAAACCATAGGCACGTGTCTTACTCTGAAGTCATGTTTTCTAATGTAGAGGAAGTCCATGTGGTTGAAGAAGATCAACCATCTGAAACAAATCGTTGCTCAAGAGAAGCAGTTGAACCAAAAAGGAGTTGA ATGAGAGTTAACCATAGAAACTTGAACAGTCTTGTTGGATATTTGAATGAAGAAAACCATATTGGCCTCATTTACGAGTACATGGCAAATGGAGATTTGGCCGAACATCTTTCAGAGGAAGTCCATGTGGTTGAAGAAGATCAACCATCTGAAACAAATCGTTGCTCAAGAGAAGCAGTTGAACCAAAAAGGAGTTGA ATGAGAGTTAACCATAGAAACTTGAACAGTCTTGTTGGATATTTGAATGAAGAAAACCATATTGGCCTCATTTACGAGTACATGGCAAATGGAGATTTGGCCGAACATCTTTCAGAGGAAGTCCATGTGGTTGAAGAAGATCAACCATCTGAAACAAATCGTTGCTCAAGAGAAGCAGTTGAACCAAAAAGGAGTTGA MRVNHRNLNSLVGYLNEENHIGLIYEYMANGDLAEHLSEEVHVVEEDQPSETNRCSREAVEPKRS*
BLAST of CsaUNG008830 vs. Swiss-Prot
Match: Y5169_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 6.9e-08 Identity = 26/38 (68.42%), Postives = 29/38 (76.32%), Query Frame = 1
BLAST of CsaUNG008830 vs. Swiss-Prot
Match: Y2899_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g28990 OS=Arabidopsis thaliana GN=At2g28990 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-07 Identity = 26/38 (68.42%), Postives = 28/38 (73.68%), Query Frame = 1
BLAST of CsaUNG008830 vs. Swiss-Prot
Match: MEE39_ARATH (Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-07 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 1
BLAST of CsaUNG008830 vs. Swiss-Prot
Match: Y5182_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.0e-07 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 1
BLAST of CsaUNG008830 vs. Swiss-Prot
Match: RLK6_ARATH (Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.6e-07 Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 1
BLAST of CsaUNG008830 vs. TrEMBL
Match: A0A0A0K792_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452200 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-12 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 1
BLAST of CsaUNG008830 vs. TrEMBL
Match: A0A0A0KCS6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452210 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-09 Identity = 31/40 (77.50%), Postives = 37/40 (92.50%), Query Frame = 1
BLAST of CsaUNG008830 vs. TrEMBL
Match: A0A0A0K7Y5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452180 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-09 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 1
BLAST of CsaUNG008830 vs. TrEMBL
Match: A0A0A0KCS2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452160 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 7.5e-09 Identity = 29/38 (76.32%), Postives = 35/38 (92.11%), Query Frame = 1
BLAST of CsaUNG008830 vs. TrEMBL
Match: A0A0A0K9P9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G452140 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.7e-08 Identity = 28/38 (73.68%), Postives = 35/38 (92.11%), Query Frame = 1
BLAST of CsaUNG008830 vs. TAIR10
Match: AT4G29990.1 (AT4G29990.1 Leucine-rich repeat transmembrane protein kinase protein) HSP 1 Score: 61.6 bits (148), Expect = 2.1e-10 Identity = 26/38 (68.42%), Postives = 31/38 (81.58%), Query Frame = 1
BLAST of CsaUNG008830 vs. TAIR10
Match: AT2G29000.1 (AT2G29000.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 60.5 bits (145), Expect = 4.6e-10 Identity = 26/40 (65.00%), Postives = 31/40 (77.50%), Query Frame = 1
BLAST of CsaUNG008830 vs. TAIR10
Match: AT2G28970.1 (AT2G28970.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 58.9 bits (141), Expect = 1.3e-09 Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 1
BLAST of CsaUNG008830 vs. TAIR10
Match: AT5G16900.1 (AT5G16900.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 57.4 bits (137), Expect = 3.9e-09 Identity = 26/38 (68.42%), Postives = 29/38 (76.32%), Query Frame = 1
BLAST of CsaUNG008830 vs. TAIR10
Match: AT3G46400.1 (AT3G46400.1 Leucine-rich repeat protein kinase family protein) HSP 1 Score: 57.0 bits (136), Expect = 5.1e-09 Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 1
BLAST of CsaUNG008830 vs. NCBI nr
Match: gi|659124864|ref|XP_008462386.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51860 [Cucumis melo]) HSP 1 Score: 79.7 bits (195), Expect = 2.1e-12 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 1
BLAST of CsaUNG008830 vs. NCBI nr
Match: gi|778729919|ref|XP_011659665.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51860 [Cucumis sativus]) HSP 1 Score: 79.0 bits (193), Expect = 3.6e-12 Identity = 36/39 (92.31%), Postives = 38/39 (97.44%), Query Frame = 1
BLAST of CsaUNG008830 vs. NCBI nr
Match: gi|778729930|ref|XP_011659668.1| (PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g51820 [Cucumis sativus]) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-09 Identity = 31/40 (77.50%), Postives = 37/40 (92.50%), Query Frame = 1
BLAST of CsaUNG008830 vs. NCBI nr
Match: gi|700190333|gb|KGN45566.1| (hypothetical protein Csa_7G452210 [Cucumis sativus]) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-09 Identity = 31/40 (77.50%), Postives = 37/40 (92.50%), Query Frame = 1
BLAST of CsaUNG008830 vs. NCBI nr
Match: gi|659125002|ref|XP_008462458.1| (PREDICTED: putative leucine-rich repeat receptor-like protein kinase At2g19210 [Cucumis melo]) HSP 1 Score: 69.7 bits (169), Expect = 2.2e-09 Identity = 30/40 (75.00%), Postives = 37/40 (92.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|