Csa7G066200 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGACGAAGTTCTTTTGTGAAAGTGAAGGGTTGTGATTGTTCAAGTAATAATTGGACACAAATCCCTATCGAAGACCCTTACTTGCAAGAAATTTCAAAGCTTGCTGTGAAAATACACAACAGTTCAGCTCAAGACAATTTGGAATACGATGGGATTTATGAAAGTTGGTATAAAAAATTGAATGACAACACCTTAGAGTATCGTTTTCTTCTCAAAGGAATCAACTATTTGGGACGTGTGAAGAACTATGAAGCTATTGTTCATGATGACATTGGTGCCACTCAAAAGAATACTAAGCTCCAATATAATCTTTCAACTTAA ATGAGACGAAGTTCTTTTGTGAAAGTGAAGGGTTGTGATTGTTCAAGTAATAATTGGACACAAATCCCTATCGAAGACCCTTACTTGCAAGAAATTTCAAAGCTTGCTGTGAAAATACACAACAGTTCAGCTCAAGACAATTTGGAATACGATGGGATTTATGAAAGTTGGTATAAAAAATTGAATGACAACACCTTAGAGTATCGTTTTCTTCTCAAAGGAATCAACTATTTGGGACGTGTGAAGAACTATGAAGCTATTGTTCATGATGACATTGGTGCCACTCAAAAGAATACTAAGCTCCAATATAATCTTTCAACTTAA ATGAGACGAAGTTCTTTTGTGAAAGTGAAGGGTTGTGATTGTTCAAGTAATAATTGGACACAAATCCCTATCGAAGACCCTTACTTGCAAGAAATTTCAAAGCTTGCTGTGAAAATACACAACAGTTCAGCTCAAGACAATTTGGAATACGATGGGATTTATGAAAGTTGGTATAAAAAATTGAATGACAACACCTTAGAGTATCGTTTTCTTCTCAAAGGAATCAACTATTTGGGACGTGTGAAGAACTATGAAGCTATTGTTCATGATGACATTGGTGCCACTCAAAAGAATACTAAGCTCCAATATAATCTTTCAACTTAA MRRSSFVKVKGCDCSSNNWTQIPIEDPYLQEISKLAVKIHNSSAQDNLEYDGIYESWYKKLNDNTLEYRFLLKGINYLGRVKNYEAIVHDDIGATQKNTKLQYNLST*
BLAST of Csa7G066200 vs. TrEMBL
Match: A0A0A0K639_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G066200 PE=4 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 1.0e-55 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of Csa7G066200 vs. TrEMBL
Match: Q7DMD5_CUCMA (Phloem filament protein (Fragment) OS=Cucurbita maxima GN=cPC7 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 6.1e-08 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Csa7G066200 vs. TrEMBL
Match: Q7DMD5_CUCMA (Phloem filament protein (Fragment) OS=Cucurbita maxima GN=cPC7 PE=2 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 9.7e-06 Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 1
HSP 2 Score: 53.5 bits (127), Expect = 1.8e-04 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
HSP 3 Score: 65.1 bits (157), Expect = 6.1e-08 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Csa7G066200 vs. TrEMBL
Match: P94012_CUCMA (Phloem filament protein OS=Cucurbita maxima GN=PP1 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 7.9e-08 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
HSP 2 Score: 62.8 bits (151), Expect = 3.0e-07 Identity = 35/96 (36.46%), Postives = 56/96 (58.33%), Query Frame = 1
HSP 3 Score: 59.3 bits (142), Expect = 3.3e-06 Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 1
HSP 4 Score: 57.8 bits (138), Expect = 9.7e-06 Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 1
HSP 5 Score: 55.1 bits (131), Expect = 6.3e-05 Identity = 31/85 (36.47%), Postives = 51/85 (60.00%), Query Frame = 1
HSP 6 Score: 53.5 bits (127), Expect = 1.8e-04 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Csa7G066200 vs. NCBI nr
Match: gi|700188529|gb|KGN43762.1| (hypothetical protein Csa_7G066200 [Cucumis sativus]) HSP 1 Score: 223.8 bits (569), Expect = 1.5e-55 Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 1
BLAST of Csa7G066200 vs. NCBI nr
Match: gi|1753099|gb|AAC12676.1| (phloem filament protein [Cucurbita maxima]) HSP 1 Score: 65.1 bits (157), Expect = 8.7e-08 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Csa7G066200 vs. NCBI nr
Match: gi|1753099|gb|AAC12676.1| (phloem filament protein [Cucurbita maxima]) HSP 1 Score: 64.7 bits (156), Expect = 1.1e-07 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
HSP 2 Score: 62.8 bits (151), Expect = 4.3e-07 Identity = 35/96 (36.46%), Postives = 56/96 (58.33%), Query Frame = 1
HSP 3 Score: 59.3 bits (142), Expect = 4.8e-06 Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 1
HSP 4 Score: 57.8 bits (138), Expect = 1.4e-05 Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 1
HSP 5 Score: 55.1 bits (131), Expect = 9.0e-05 Identity = 31/85 (36.47%), Postives = 51/85 (60.00%), Query Frame = 1
HSP 6 Score: 53.5 bits (127), Expect = 2.6e-04 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
HSP 7 Score: 65.1 bits (157), Expect = 8.7e-08 Identity = 30/85 (35.29%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Csa7G066200 vs. NCBI nr
Match: gi|1753097|gb|AAC12675.1| (phloem filament protein [Cucurbita maxima]) HSP 1 Score: 57.8 bits (138), Expect = 1.4e-05 Identity = 26/72 (36.11%), Postives = 46/72 (63.89%), Query Frame = 1
HSP 2 Score: 53.5 bits (127), Expect = 2.6e-04 Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 1
HSP 3 Score: 60.5 bits (145), Expect = 2.1e-06 Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 1
BLAST of Csa7G066200 vs. NCBI nr
Match: gi|778730266|ref|XP_011659743.1| (PREDICTED: uncharacterized protein LOC101206992 [Cucumis sativus]) HSP 1 Score: 56.6 bits (135), Expect = 3.1e-05 Identity = 28/85 (32.94%), Postives = 48/85 (56.47%), Query Frame = 1
HSP 2 Score: 47.4 bits (111), Expect = 1.9e-02 Identity = 23/78 (29.49%), Postives = 44/78 (56.41%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |