Csa7G009070 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AACCACAAGTCTTCACATTCTAGTTTGAAAGAAAAAAAATTCTTCTCTCGAAAACGTGTTCTACGATTTCTCTTTGCTTTAAATATAGTAATTATACCGTTCAACATGAGGCTCATCCATCTTCTTAAAAGAAGCCAAGGAGTTTCATCAATTCCCAAGGGCTATTGTGCAGTATATGTTGGAGAGAGCCAAAAGAAGCGTTTCATAATTCCAATTAGTTACTTGAATCAACCATGTTTTCAAGAGTTGCTTAGCCAAACTGAAGAAGAATTCGGGTACCATCATCCAATGGGAGGTCTTACTATTCATTGCAAAGATGCCATCTTCACTAATCTCATCTCTCGTTTGAATGATCTATGAGAGACGAATAACATTTTCAAAATACAAAAACTCTGATAGCTAGAAATAACCAACACTTCATGTACATTTTTTTTCTTTCATTTTCGTCATTTTTTTGTTTCCTTTAGTGGGGAGTAAAATAATGTTTCCCTGGTTAAGGAAATTACCCAAGGATGAAATGAAATGAAATAACTTCAGTTCTAC ATGAGGCTCATCCATCTTCTTAAAAGAAGCCAAGGAGTTTCATCAATTCCCAAGGGCTATTGTGCAGTATATGTTGGAGAGAGCCAAAAGAAGCGTTTCATAATTCCAATTAGTTACTTGAATCAACCATGTTTTCAAGAGTTGCTTAGCCAAACTGAAGAAGAATTCGGGTACCATCATCCAATGGGAGGTCTTACTATTCATTGCAAAGATGCCATCTTCACTAATCTCATCTCTCGTTTGAATGATCTATGA ATGAGGCTCATCCATCTTCTTAAAAGAAGCCAAGGAGTTTCATCAATTCCCAAGGGCTATTGTGCAGTATATGTTGGAGAGAGCCAAAAGAAGCGTTTCATAATTCCAATTAGTTACTTGAATCAACCATGTTTTCAAGAGTTGCTTAGCCAAACTGAAGAAGAATTCGGGTACCATCATCCAATGGGAGGTCTTACTATTCATTGCAAAGATGCCATCTTCACTAATCTCATCTCTCGTTTGAATGATCTATGA MRLIHLLKRSQGVSSIPKGYCAVYVGESQKKRFIIPISYLNQPCFQELLSQTEEEFGYHHPMGGLTIHCKDAIFTNLISRLNDL*
BLAST of Csa7G009070 vs. Swiss-Prot
Match: SAU24_ARATH (Auxin-responsive protein SAUR24 OS=Arabidopsis thaliana GN=SAUR24 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.2e-22 Identity = 50/77 (64.94%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of Csa7G009070 vs. Swiss-Prot
Match: SAU23_ARATH (Auxin-responsive protein SAUR23 OS=Arabidopsis thaliana GN=SAUR23 PE=2 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 4.9e-22 Identity = 48/77 (62.34%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of Csa7G009070 vs. Swiss-Prot
Match: SAU22_ARATH (Auxin-responsive protein SAUR22 OS=Arabidopsis thaliana GN=SAUR22 PE=2 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 8.3e-22 Identity = 47/76 (61.84%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Csa7G009070 vs. Swiss-Prot
Match: SAU20_ARATH (Auxin-responsive protein SAUR20 OS=Arabidopsis thaliana GN=SAUR20 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.9e-21 Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 1
BLAST of Csa7G009070 vs. Swiss-Prot
Match: SAU21_ARATH (Auxin-responsive protein SAUR21 OS=Arabidopsis thaliana GN=SAUR21 PE=2 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.4e-21 Identity = 48/76 (63.16%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Csa7G009070 vs. TrEMBL
Match: A0A0A0K5U4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009070 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 1.9e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa7G009070 vs. TrEMBL
Match: A0A0A0K4K1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009080 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 7.8e-35 Identity = 69/84 (82.14%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of Csa7G009070 vs. TrEMBL
Match: A0A0A0K2F9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009050 PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.4e-28 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Csa7G009070 vs. TrEMBL
Match: A0A0A0K5V1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009120 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 7.8e-27 Identity = 61/88 (69.32%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Csa7G009070 vs. TrEMBL
Match: M0ZMZ7_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400001647 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.8e-24 Identity = 53/83 (63.86%), Postives = 67/83 (80.72%), Query Frame = 1
BLAST of Csa7G009070 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 105.9 bits (263), Expect = 1.2e-23 Identity = 50/77 (64.94%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of Csa7G009070 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 104.8 bits (260), Expect = 2.7e-23 Identity = 48/77 (62.34%), Postives = 60/77 (77.92%), Query Frame = 1
BLAST of Csa7G009070 vs. TAIR10
Match: AT5G18050.1 (AT5G18050.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 104.0 bits (258), Expect = 4.7e-23 Identity = 47/76 (61.84%), Postives = 59/76 (77.63%), Query Frame = 1
BLAST of Csa7G009070 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.8 bits (255), Expect = 1.0e-22 Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 1
BLAST of Csa7G009070 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.1 bits (253), Expect = 1.8e-22 Identity = 49/84 (58.33%), Postives = 58/84 (69.05%), Query Frame = 1
BLAST of Csa7G009070 vs. NCBI nr
Match: gi|778722852|ref|XP_011658582.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 176.0 bits (445), Expect = 2.8e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa7G009070 vs. NCBI nr
Match: gi|700187979|gb|KGN43212.1| (hypothetical protein Csa_7G009080 [Cucumis sativus]) HSP 1 Score: 154.1 bits (388), Expect = 1.1e-34 Identity = 69/84 (82.14%), Postives = 80/84 (95.24%), Query Frame = 1
BLAST of Csa7G009070 vs. NCBI nr
Match: gi|700187976|gb|KGN43209.1| (hypothetical protein Csa_7G009050 [Cucumis sativus]) HSP 1 Score: 133.3 bits (334), Expect = 2.0e-28 Identity = 62/87 (71.26%), Postives = 75/87 (86.21%), Query Frame = 1
BLAST of Csa7G009070 vs. NCBI nr
Match: gi|700187983|gb|KGN43216.1| (hypothetical protein Csa_7G009120 [Cucumis sativus]) HSP 1 Score: 127.5 bits (319), Expect = 1.1e-26 Identity = 61/88 (69.32%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Csa7G009070 vs. NCBI nr
Match: gi|565387883|ref|XP_006359717.1| (PREDICTED: auxin-induced protein 15A-like [Solanum tuberosum]) HSP 1 Score: 119.0 bits (297), Expect = 4.0e-24 Identity = 53/83 (63.86%), Postives = 67/83 (80.72%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |