Csa7G009010 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AACAAGAGTCTTTCCATATTCCAACTCTCAAAAGCAATTTTCCAAGTTCTTTTTGGTGCATATTTATAACATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCCAAGTCTTCAGCGCTCTTCATCAACAGGGAATGGAGCATCTCCAAAGTCTATCGATGTTCCAAAGGGATACTTTACAGTTTATGTCGGTGAGGTAGAAAAGAAGCGTTTTGTCATCCCACTATCTTACTTGAACCAGTCATCTTTTCAAGATTTGTTGAGTCAATCAGAAGAAGAATTTGGATACAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTTTTTCCTTTATTTCACCAAAAGTTTGAATGACCCATGAAGTAAAGAGATTAGTATCTAGAAATAGATAGAATATACAAGG ATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCCAAGTCTTCAGCGCTCTTCATCAACAGGGAATGGAGCATCTCCAAAGTCTATCGATGTTCCAAAGGGATACTTTACAGTTTATGTCGGTGAGGTAGAAAAGAAGCGTTTTGTCATCCCACTATCTTACTTGAACCAGTCATCTTTTCAAGATTTGTTGAGTCAATCAGAAGAAGAATTTGGATACAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTTTTTCCTTTATTTCACCAAAAGTTTGAATGACCCATGA ATGGGTTTCCGTCTACCTAGAATTGTTACTGCTAAGCCAAGTCTTCAGCGCTCTTCATCAACAGGGAATGGAGCATCTCCAAAGTCTATCGATGTTCCAAAGGGATACTTTACAGTTTATGTCGGTGAGGTAGAAAAGAAGCGTTTTGTCATCCCACTATCTTACTTGAACCAGTCATCTTTTCAAGATTTGTTGAGTCAATCAGAAGAAGAATTTGGATACAATCATCCAATGGGTGGCATCACAATTCCTTGCAGTGAAGACTTTTTCCTTTATTTCACCAAAAGTTTGAATGACCCATGA MGFRLPRIVTAKPSLQRSSSTGNGASPKSIDVPKGYFTVYVGEVEKKRFVIPLSYLNQSSFQDLLSQSEEEFGYNHPMGGITIPCSEDFFLYFTKSLNDP*
BLAST of Csa7G009010 vs. Swiss-Prot
Match: AX10A_SOYBN (Auxin-induced protein X10A OS=Glycine max PE=2 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.6e-27 Identity = 61/99 (61.62%), Postives = 73/99 (73.74%), Query Frame = 1
BLAST of Csa7G009010 vs. Swiss-Prot
Match: AX6B_SOYBN (Auxin-induced protein 6B OS=Glycine max PE=2 SV=1) HSP 1 Score: 117.9 bits (294), Expect = 6.6e-26 Identity = 60/98 (61.22%), Postives = 72/98 (73.47%), Query Frame = 1
BLAST of Csa7G009010 vs. Swiss-Prot
Match: ARG7_VIGRR (Indole-3-acetic acid-induced protein ARG7 OS=Vigna radiata var. radiata GN=ARG7 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.9e-25 Identity = 60/98 (61.22%), Postives = 69/98 (70.41%), Query Frame = 1
BLAST of Csa7G009010 vs. Swiss-Prot
Match: AX15A_SOYBN (Auxin-induced protein 15A OS=Glycine max PE=2 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.7e-24 Identity = 60/98 (61.22%), Postives = 64/98 (65.31%), Query Frame = 1
BLAST of Csa7G009010 vs. Swiss-Prot
Match: A10A5_SOYBN (Auxin-induced protein 10A5 OS=Glycine max PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 2.4e-23 Identity = 56/99 (56.57%), Postives = 70/99 (70.71%), Query Frame = 1
BLAST of Csa7G009010 vs. TrEMBL
Match: A0A0A0K0H9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009010 PE=4 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 2.1e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa7G009010 vs. TrEMBL
Match: A0A0A0K4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008980 PE=4 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 1.0e-41 Identity = 84/99 (84.85%), Postives = 92/99 (92.93%), Query Frame = 1
BLAST of Csa7G009010 vs. TrEMBL
Match: A0A0A0K5T8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G009020 PE=4 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 3.0e-41 Identity = 86/99 (86.87%), Postives = 90/99 (90.91%), Query Frame = 1
BLAST of Csa7G009010 vs. TrEMBL
Match: A0A0A0K160_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008990 PE=4 SV=1) HSP 1 Score: 175.6 bits (444), Expect = 3.0e-41 Identity = 85/99 (85.86%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Csa7G009010 vs. TrEMBL
Match: A0A0A0K0H6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G008960 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 5.8e-37 Identity = 80/101 (79.21%), Postives = 88/101 (87.13%), Query Frame = 1
BLAST of Csa7G009010 vs. TAIR10
Match: AT4G38840.1 (AT4G38840.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 114.4 bits (285), Expect = 4.1e-26 Identity = 52/99 (52.53%), Postives = 71/99 (71.72%), Query Frame = 1
BLAST of Csa7G009010 vs. TAIR10
Match: AT5G18080.1 (AT5G18080.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 103.6 bits (257), Expect = 7.3e-23 Identity = 50/90 (55.56%), Postives = 63/90 (70.00%), Query Frame = 1
BLAST of Csa7G009010 vs. TAIR10
Match: AT5G18010.1 (AT5G18010.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 102.1 bits (253), Expect = 2.1e-22 Identity = 50/90 (55.56%), Postives = 63/90 (70.00%), Query Frame = 1
BLAST of Csa7G009010 vs. TAIR10
Match: AT5G18060.1 (AT5G18060.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 4.7e-22 Identity = 49/91 (53.85%), Postives = 63/91 (69.23%), Query Frame = 1
BLAST of Csa7G009010 vs. TAIR10
Match: AT5G18020.1 (AT5G18020.1 SAUR-like auxin-responsive protein family ) HSP 1 Score: 100.9 bits (250), Expect = 4.7e-22 Identity = 48/87 (55.17%), Postives = 62/87 (71.26%), Query Frame = 1
BLAST of Csa7G009010 vs. NCBI nr
Match: gi|700187972|gb|KGN43205.1| (hypothetical protein Csa_7G009010 [Cucumis sativus]) HSP 1 Score: 206.1 bits (523), Expect = 3.0e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 1
BLAST of Csa7G009010 vs. NCBI nr
Match: gi|659094352|ref|XP_008448014.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis melo]) HSP 1 Score: 177.6 bits (449), Expect = 1.1e-41 Identity = 85/99 (85.86%), Postives = 92/99 (92.93%), Query Frame = 1
BLAST of Csa7G009010 vs. NCBI nr
Match: gi|778722823|ref|XP_011658575.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 177.2 bits (448), Expect = 1.5e-41 Identity = 84/99 (84.85%), Postives = 92/99 (92.93%), Query Frame = 1
BLAST of Csa7G009010 vs. NCBI nr
Match: gi|659094354|ref|XP_008448015.1| (PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein X10A-like [Cucumis melo]) HSP 1 Score: 176.0 bits (445), Expect = 3.3e-41 Identity = 85/99 (85.86%), Postives = 91/99 (91.92%), Query Frame = 1
BLAST of Csa7G009010 vs. NCBI nr
Match: gi|778722820|ref|XP_011658574.1| (PREDICTED: auxin-induced protein 15A-like [Cucumis sativus]) HSP 1 Score: 175.6 bits (444), Expect = 4.3e-41 Identity = 85/99 (85.86%), Postives = 91/99 (91.92%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |