Csa6G504410 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.ACAATTCCACAAGAATTTCAGAGAGAAATCCTCCATTATACTCTTTTTCCAATTTCCCATGGCCGTAACTAAAACCGTTATGAAACTTGATATTGCATGCCAAAAATGCAAAACCAAAGTTCTTAAAGCCGTTACCGCCATTGAAGGTACCTTTCTTCATCTTCTTCTTTGGATATATCATTATTAAACTCCTTAACTTCCATATAAATCTTTTATTTTCTTTATGAATTTTGTAAACTAACTATAGGTGTCGACAAGGTCGAGACAGATGAAGCTAAGGGAACTTTGGCTGTGATCGGCACGGCAGATCCATTTGAGATAGTTAAACGTACAAGAAAGGCGATTGCTTGTGCTGGCAAGGTCGCCGATGTAGTGAGCATTGGACCGCCACCCAAACCAGACGAGAAAAAACCGGAGGAGAAAAAACAGGAGGAGAAGAAACCAGTAGACAAGAAACCCGACCCGCCTCCTTGCCCATGTCCACCCTACCCCTGCCCACCTTATTATGGATCGTCCTATGTGATCGTACCCCATGAAACTTATCCTTCTTGCTCTATTCTTTAA ATGGCCGTAACTAAAACCGTTATGAAACTTGATATTGCATGCCAAAAATGCAAAACCAAAGTTCTTAAAGCCGTTACCGCCATTGAAGGTGTCGACAAGGTCGAGACAGATGAAGCTAAGGGAACTTTGGCTGTGATCGGCACGGCAGATCCATTTGAGATAGTTAAACGTACAAGAAAGGCGATTGCTTGTGCTGGCAAGGTCGCCGATGTAGTGAGCATTGGACCGCCACCCAAACCAGACGAGAAAAAACCGGAGGAGAAAAAACAGGAGGAGAAGAAACCAGTAGACAAGAAACCCGACCCGCCTCCTTGCCCATGTCCACCCTACCCCTGCCCACCTTATTATGGATCGTCCTATGTGATCGTACCCCATGAAACTTATCCTTCTTGCTCTATTCTTTAA ATGGCCGTAACTAAAACCGTTATGAAACTTGATATTGCATGCCAAAAATGCAAAACCAAAGTTCTTAAAGCCGTTACCGCCATTGAAGGTGTCGACAAGGTCGAGACAGATGAAGCTAAGGGAACTTTGGCTGTGATCGGCACGGCAGATCCATTTGAGATAGTTAAACGTACAAGAAAGGCGATTGCTTGTGCTGGCAAGGTCGCCGATGTAGTGAGCATTGGACCGCCACCCAAACCAGACGAGAAAAAACCGGAGGAGAAAAAACAGGAGGAGAAGAAACCAGTAGACAAGAAACCCGACCCGCCTCCTTGCCCATGTCCACCCTACCCCTGCCCACCTTATTATGGATCGTCCTATGTGATCGTACCCCATGAAACTTATCCTTCTTGCTCTATTCTTTAA MAVTKTVMKLDIACQKCKTKVLKAVTAIEGVDKVETDEAKGTLAVIGTADPFEIVKRTRKAIACAGKVADVVSIGPPPKPDEKKPEEKKQEEKKPVDKKPDPPPCPCPPYPCPPYYGSSYVIVPHETYPSCSIL*
BLAST of Csa6G504410 vs. Swiss-Prot
Match: HIP3_ARATH (Heavy metal-associated isoprenylated plant protein 3 OS=Arabidopsis thaliana GN=HIPP3 PE=1 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.3e-08 Identity = 39/108 (36.11%), Postives = 57/108 (52.78%), Query Frame = 1
BLAST of Csa6G504410 vs. TrEMBL
Match: A0A0A0KJ75_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G504410 PE=4 SV=1) HSP 1 Score: 282.7 bits (722), Expect = 2.3e-73 Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
BLAST of Csa6G504410 vs. TrEMBL
Match: B9HF42_POPTR (Heavy-metal-associated domain-containing family protein OS=Populus trichocarpa GN=POPTR_0007s13270g PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.5e-27 Identity = 74/142 (52.11%), Postives = 91/142 (64.08%), Query Frame = 1
BLAST of Csa6G504410 vs. TrEMBL
Match: V7CFJ8_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_002G033800g PE=4 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 3.3e-27 Identity = 76/144 (52.78%), Postives = 94/144 (65.28%), Query Frame = 1
BLAST of Csa6G504410 vs. TrEMBL
Match: I1LHW0_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G071500 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.6e-26 Identity = 73/136 (53.68%), Postives = 90/136 (66.18%), Query Frame = 1
BLAST of Csa6G504410 vs. TrEMBL
Match: A0A0B2S5G6_GLYSO (Uncharacterized protein OS=Glycine soja GN=glysoja_003686 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.6e-26 Identity = 73/136 (53.68%), Postives = 90/136 (66.18%), Query Frame = 1
BLAST of Csa6G504410 vs. TAIR10
Match: AT3G05920.1 (AT3G05920.1 Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 94.4 bits (233), Expect = 5.9e-20 Identity = 55/138 (39.86%), Postives = 73/138 (52.90%), Query Frame = 1
BLAST of Csa6G504410 vs. TAIR10
Match: AT5G52740.1 (AT5G52740.1 Copper transport protein family) HSP 1 Score: 74.3 bits (181), Expect = 6.3e-14 Identity = 41/110 (37.27%), Postives = 58/110 (52.73%), Query Frame = 1
BLAST of Csa6G504410 vs. TAIR10
Match: AT5G26690.1 (AT5G26690.1 Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 73.6 bits (179), Expect = 1.1e-13 Identity = 38/89 (42.70%), Postives = 53/89 (59.55%), Query Frame = 1
BLAST of Csa6G504410 vs. TAIR10
Match: AT1G01490.1 (AT1G01490.1 Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 67.4 bits (163), Expect = 7.7e-12 Identity = 36/100 (36.00%), Postives = 52/100 (52.00%), Query Frame = 1
BLAST of Csa6G504410 vs. TAIR10
Match: AT3G07600.1 (AT3G07600.1 Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-10 Identity = 48/157 (30.57%), Postives = 70/157 (44.59%), Query Frame = 1
BLAST of Csa6G504410 vs. NCBI nr
Match: gi|778722481|ref|XP_011658496.1| (PREDICTED: uncharacterized protein LOC105436033 [Cucumis sativus]) HSP 1 Score: 282.7 bits (722), Expect = 3.3e-73 Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 1
BLAST of Csa6G504410 vs. NCBI nr
Match: gi|659080373|ref|XP_008440757.1| (PREDICTED: uncharacterized protein LOC103485075 [Cucumis melo]) HSP 1 Score: 251.9 bits (642), Expect = 6.3e-64 Identity = 120/135 (88.89%), Postives = 126/135 (93.33%), Query Frame = 1
BLAST of Csa6G504410 vs. NCBI nr
Match: gi|743791725|ref|XP_011042132.1| (PREDICTED: uncharacterized protein LOC105137896 [Populus euphratica]) HSP 1 Score: 138.7 bits (348), Expect = 7.7e-30 Identity = 75/145 (51.72%), Postives = 95/145 (65.52%), Query Frame = 1
BLAST of Csa6G504410 vs. NCBI nr
Match: gi|1009144833|ref|XP_015890015.1| (PREDICTED: uncharacterized protein LOC107424680 [Ziziphus jujuba]) HSP 1 Score: 135.2 bits (339), Expect = 8.6e-29 Identity = 71/134 (52.99%), Postives = 95/134 (70.90%), Query Frame = 1
BLAST of Csa6G504410 vs. NCBI nr
Match: gi|694426120|ref|XP_009340756.1| (PREDICTED: uncharacterized protein LOC103932830 [Pyrus x bretschneideri]) HSP 1 Score: 134.0 bits (336), Expect = 1.9e-28 Identity = 74/132 (56.06%), Postives = 92/132 (69.70%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |