Csa6G501310 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGACTTGCTTGATGGTTTTTGGGAGGAAATTTGGGGATGAGGAGTTGGATGATAGAGGTTTCAAGGCTATGATACAAGAGGTGATGCAATTAGTTGCTGCTCCTAATTTGGGAGATCTTATTCCTTTTATTGCAATGTTTGATCTTCAAGGGTTGACACGTCGGATGAAAAATATTAACAAAGTGTTTGATAGGTTTTTTGAGAGGATTATTGATGAACATCTTAAGTCCATGGGTGAAAAAAAAACTAAAGATTTTTTAGATGTCATGTTGGATCTAATGAAGTCTGAAGATACTCATGAGTATCGAATTGATCGTTCCAGTGTTAAAGCAATAATATTGGTAAGAATTTAA ATGACTTGCTTGATGGTTTTTGGGAGGAAATTTGGGGATGAGGAGTTGGATGATAGAGGTTTCAAGGCTATGATACAAGAGGTGATGCAATTAGTTGCTGCTCCTAATTTGGGAGATCTTATTCCTTTTATTGCAATGTTTGATCTTCAAGGGTTGACACGTCGGATGAAAAATATTAACAAAGTGTTTGATAGGTTTTTTGAGAGGATTATTGATGAACATCTTAAGTCCATGGGTGAAAAAAAAACTAAAGATTTTTTAGATGTCATGTTGGATCTAATGAAGTCTGAAGATACTCATGAGTATCGAATTGATCGTTCCAGTGTTAAAGCAATAATATTGGTAAGAATTTAA ATGACTTGCTTGATGGTTTTTGGGAGGAAATTTGGGGATGAGGAGTTGGATGATAGAGGTTTCAAGGCTATGATACAAGAGGTGATGCAATTAGTTGCTGCTCCTAATTTGGGAGATCTTATTCCTTTTATTGCAATGTTTGATCTTCAAGGGTTGACACGTCGGATGAAAAATATTAACAAAGTGTTTGATAGGTTTTTTGAGAGGATTATTGATGAACATCTTAAGTCCATGGGTGAAAAAAAAACTAAAGATTTTTTAGATGTCATGTTGGATCTAATGAAGTCTGAAGATACTCATGAGTATCGAATTGATCGTTCCAGTGTTAAAGCAATAATATTGGTAAGAATTTAA MTCLMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLIPFIAMFDLQGLTRRMKNINKVFDRFFERIIDEHLKSMGEKKTKDFLDVMLDLMKSEDTHEYRIDRSSVKAIILVRI*
BLAST of Csa6G501310 vs. Swiss-Prot
Match: C71AS_ARATH (Putative cytochrome P450 71A28 OS=Arabidopsis thaliana GN=CYP71A28 PE=3 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 1.0e-14 Identity = 42/113 (37.17%), Postives = 73/113 (64.60%), Query Frame = 1
BLAST of Csa6G501310 vs. Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 2.0e-13 Identity = 40/112 (35.71%), Postives = 68/112 (60.71%), Query Frame = 1
BLAST of Csa6G501310 vs. Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 3.4e-13 Identity = 43/114 (37.72%), Postives = 66/114 (57.89%), Query Frame = 1
BLAST of Csa6G501310 vs. Swiss-Prot
Match: C75A7_EUSER (Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 8.3e-12 Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 1
BLAST of Csa6G501310 vs. Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 1
BLAST of Csa6G501310 vs. TrEMBL
Match: A0A0A0KGC7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G501310 PE=4 SV=1) HSP 1 Score: 233.0 bits (593), Expect = 1.8e-58 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa6G501310 vs. TrEMBL
Match: A0A0A0KIZ7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G501300 PE=4 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 2.2e-48 Identity = 101/118 (85.59%), Postives = 109/118 (92.37%), Query Frame = 1
BLAST of Csa6G501310 vs. TrEMBL
Match: A0A0A0KM23_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G501360 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 6.8e-37 Identity = 78/115 (67.83%), Postives = 99/115 (86.09%), Query Frame = 1
BLAST of Csa6G501310 vs. TrEMBL
Match: M5WSS3_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa022041mg PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 2.2e-35 Identity = 75/114 (65.79%), Postives = 96/114 (84.21%), Query Frame = 1
BLAST of Csa6G501310 vs. TrEMBL
Match: A0A0A0KK86_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G501325 PE=4 SV=1) HSP 1 Score: 154.1 bits (388), Expect = 1.1e-34 Identity = 74/113 (65.49%), Postives = 94/113 (83.19%), Query Frame = 1
BLAST of Csa6G501310 vs. TAIR10
Match: AT5G44620.1 (AT5G44620.1 cytochrome P450, family 706, subfamily A, polypeptide 3) HSP 1 Score: 68.9 bits (167), Expect = 2.3e-12 Identity = 38/115 (33.04%), Postives = 67/115 (58.26%), Query Frame = 1
BLAST of Csa6G501310 vs. TAIR10
Match: AT4G12300.1 (AT4G12300.1 cytochrome P450, family 706, subfamily A, polypeptide 4) HSP 1 Score: 68.2 bits (165), Expect = 4.0e-12 Identity = 40/119 (33.61%), Postives = 66/119 (55.46%), Query Frame = 1
BLAST of Csa6G501310 vs. TAIR10
Match: AT5G07990.1 (AT5G07990.1 Cytochrome P450 superfamily protein) HSP 1 Score: 62.0 bits (149), Expect = 2.8e-10 Identity = 36/114 (31.58%), Postives = 61/114 (53.51%), Query Frame = 1
BLAST of Csa6G501310 vs. TAIR10
Match: AT3G48290.2 (AT3G48290.2 cytochrome P450, family 71, subfamily A, polypeptide 24) HSP 1 Score: 61.2 bits (147), Expect = 4.8e-10 Identity = 36/115 (31.30%), Postives = 66/115 (57.39%), Query Frame = 1
BLAST of Csa6G501310 vs. TAIR10
Match: AT3G48300.1 (AT3G48300.1 cytochrome P450, family 71, subfamily A, polypeptide 23) HSP 1 Score: 60.5 bits (145), Expect = 8.3e-10 Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 1
BLAST of Csa6G501310 vs. NCBI nr
Match: gi|700193586|gb|KGN48790.1| (hypothetical protein Csa_6G501310 [Cucumis sativus]) HSP 1 Score: 233.0 bits (593), Expect = 2.6e-58 Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 1
BLAST of Csa6G501310 vs. NCBI nr
Match: gi|449451489|ref|XP_004143494.1| (PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]) HSP 1 Score: 228.0 bits (580), Expect = 8.5e-57 Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 1
BLAST of Csa6G501310 vs. NCBI nr
Match: gi|700193585|gb|KGN48789.1| (hypothetical protein Csa_6G501300 [Cucumis sativus]) HSP 1 Score: 199.5 bits (506), Expect = 3.2e-48 Identity = 101/118 (85.59%), Postives = 109/118 (92.37%), Query Frame = 1
BLAST of Csa6G501310 vs. NCBI nr
Match: gi|778719319|ref|XP_004143566.2| (PREDICTED: cytochrome P450 CYP736A12-like [Cucumis sativus]) HSP 1 Score: 194.5 bits (493), Expect = 1.0e-46 Identity = 98/115 (85.22%), Postives = 106/115 (92.17%), Query Frame = 1
BLAST of Csa6G501310 vs. NCBI nr
Match: gi|700193592|gb|KGN48796.1| (hypothetical protein Csa_6G501360 [Cucumis sativus]) HSP 1 Score: 161.4 bits (407), Expect = 9.7e-37 Identity = 78/115 (67.83%), Postives = 99/115 (86.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|