Csa6G381840 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTCCTGAACACAGCCGCCTCCAAAATCCTTCAAAAAGGCCGCCAAAAATCTCCGTTTGCTTTCATTCAGAAGTTCGGCTATGTCGATGTTTACATGAAGTGGAAGAAAGATTCATACTACGATTCCATTGAGCATATCACCAAATCCATTGAACTCAAATCCATTATCTCTCTCAAAAATTGCATCGCTCAAGACCCAAATGGGTGTATCCCAATTTCCGCCGTTTCAAAGCGAGGCCTCGAAATGGGCGTCTCGATGAAAGTTTAG ATGTTCCTGAACACAGCCGCCTCCAAAATCCTTCAAAAAGGCCGCCAAAAATCTCCGTTTGCTTTCATTCAGAAGTTCGGCTATGTCGATGTTTACATGAAGTGGAAGAAAGATTCATACTACGATTCCATTGAGCATATCACCAAATCCATTGAACTCAAATCCATTATCTCTCTCAAAAATTGCATCGCTCAAGACCCAAATGGGTGTATCCCAATTTCCGCCGTTTCAAAGCGAGGCCTCGAAATGGGCGTCTCGATGAAAGTTTAG ATGTTCCTGAACACAGCCGCCTCCAAAATCCTTCAAAAAGGCCGCCAAAAATCTCCGTTTGCTTTCATTCAGAAGTTCGGCTATGTCGATGTTTACATGAAGTGGAAGAAAGATTCATACTACGATTCCATTGAGCATATCACCAAATCCATTGAACTCAAATCCATTATCTCTCTCAAAAATTGCATCGCTCAAGACCCAAATGGGTGTATCCCAATTTCCGCCGTTTCAAAGCGAGGCCTCGAAATGGGCGTCTCGATGAAAGTTTAG MFLNTAASKILQKGRQKSPFAFIQKFGYVDVYMKWKKDSYYDSIEHITKSIELKSIISLKNCIAQDPNGCIPISAVSKRGLEMGVSMKV*
BLAST of Csa6G381840 vs. TrEMBL
Match: A0A0A0KTJ8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G622690 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa6G381840 vs. TrEMBL
Match: A0A0A0KFR4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G381840 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 8.2e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa6G381840 vs. TrEMBL
Match: A0A072TWK7_MEDTR (Plant organelle RNA recognition domain protein OS=Medicago truncatula GN=MTR_7g018630 PE=4 SV=1) HSP 1 Score: 120.6 bits (301), Expect = 1.0e-24 Identity = 55/71 (77.46%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Csa6G381840 vs. TrEMBL
Match: A0A151SB93_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_026134 PE=4 SV=1) HSP 1 Score: 116.7 bits (291), Expect = 1.5e-23 Identity = 54/71 (76.06%), Postives = 63/71 (88.73%), Query Frame = 1
BLAST of Csa6G381840 vs. TrEMBL
Match: A0A0R0I9X5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_09G029500 PE=4 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.3e-23 Identity = 59/90 (65.56%), Postives = 68/90 (75.56%), Query Frame = 1
BLAST of Csa6G381840 vs. TAIR10
Match: AT2G39120.1 (AT2G39120.1 Ubiquitin carboxyl-terminal hydrolase family protein) HSP 1 Score: 95.5 bits (236), Expect = 1.8e-20 Identity = 42/66 (63.64%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of Csa6G381840 vs. NCBI nr
Match: gi|449449483|ref|XP_004142494.1| (PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 [Cucumis sativus]) HSP 1 Score: 180.6 bits (457), Expect = 1.2e-42 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa6G381840 vs. NCBI nr
Match: gi|700192490|gb|KGN47694.1| (hypothetical protein Csa_6G381840 [Cucumis sativus]) HSP 1 Score: 180.6 bits (457), Expect = 1.2e-42 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Csa6G381840 vs. NCBI nr
Match: gi|659092014|ref|XP_008446854.1| (PREDICTED: protein ROOT PRIMORDIUM DEFECTIVE 1 [Cucumis melo]) HSP 1 Score: 166.8 bits (421), Expect = 1.8e-38 Identity = 84/89 (94.38%), Postives = 86/89 (96.63%), Query Frame = 1
BLAST of Csa6G381840 vs. NCBI nr
Match: gi|922341596|ref|XP_013447737.1| (plant organelle RNA recognition domain protein [Medicago truncatula]) HSP 1 Score: 120.6 bits (301), Expect = 1.5e-24 Identity = 55/71 (77.46%), Postives = 64/71 (90.14%), Query Frame = 1
BLAST of Csa6G381840 vs. NCBI nr
Match: gi|1012340842|gb|KYP52053.1| (hypothetical protein KK1_026134 [Cajanus cajan]) HSP 1 Score: 116.7 bits (291), Expect = 2.1e-23 Identity = 54/71 (76.06%), Postives = 63/71 (88.73%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|