Csa6G365140 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAAGAGGAGTTCGGCGAGGCTATCCGACCGGAATTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGACATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTTTCATGCGCCACCGAACTCTTCCTTAAGCTTCTAGCTGAAAAATCTGCAGAATCCGCCGCTGAGAAGAAACGGAAGACCGTGAAGCTTGAACACATTCGAATGGCCGTCAAAAGGCATCGCTCGATCAGTGATTTTCTTCTCGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGATGCGCCGGCGAAGGACGAGAATCGCACTCGCGCTGTTGTTGATAAAGTGGCTCCTGAAGGAACGCGTCGAATCGATGATTTCTTTCGTCGGTCAACTAAGACAAAGTCGGCGGAGACCGAGTCATAG ATGGAGGAAGAGGAGTTCGGCGAGGCTATCCGACCGGAATTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGACATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTTTCATGCGCCACCGAACTCTTCCTTAAGCTTCTAGCTGAAAAATCTGCAGAATCCGCCGCTGAGAAGAAACGGAAGACCGTGAAGCTTGAACACATTCGAATGGCCGTCAAAAGGCATCGCTCGATCAGTGATTTTCTTCTCGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGATGCGCCGGCGAAGGACGAGAATCGCACTCGCGCTGTTGTTGATAAAGTGGCTCCTGAAGGAACGCGTCGAATCGATGATTTCTTTCGTCGGTCAACTAAGACAAAGTCGGCGGAGACCGAGTCATAG ATGGAGGAAGAGGAGTTCGGCGAGGCTATCCGACCGGAATTTCCGACGGGACGAGTGAAGAAGATAATGAAGCTCGACAAGGACATTGGCAAAGTGAATTCAGAAGCCTTGTTTCTAGTTTCATGCGCCACCGAACTCTTCCTTAAGCTTCTAGCTGAAAAATCTGCAGAATCCGCCGCTGAGAAGAAACGGAAGACCGTGAAGCTTGAACACATTCGAATGGCCGTCAAAAGGCATCGCTCGATCAGTGATTTTCTTCTCGATTCGCTTCCTCTTCCGTCTCAGCCGTCGGATGCGCCGGCGAAGGACGAGAATCGCACTCGCGCTGTTGTTGATAAAGTGGCTCCTGAAGGAACGCGTCGAATCGATGATTTCTTTCGTCGGTCAACTAAGACAAAGTCGGCGGAGACCGAGTCATAG MEEEEFGEAIRPEFPTGRVKKIMKLDKDIGKVNSEALFLVSCATELFLKLLAEKSAESAAEKKRKTVKLEHIRMAVKRHRSISDFLLDSLPLPSQPSDAPAKDENRTRAVVDKVAPEGTRRIDDFFRRSTKTKSAETES*
BLAST of Csa6G365140 vs. Swiss-Prot
Match: NFYC1_ARATH (Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana GN=NFYC1 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.5e-07 Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Csa6G365140 vs. Swiss-Prot
Match: NFYC4_ARATH (Nuclear transcription factor Y subunit C-4 OS=Arabidopsis thaliana GN=NFYC4 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.5e-07 Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Csa6G365140 vs. Swiss-Prot
Match: DPB3_SCHPO (DNA polymerase epsilon subunit C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpb3 PE=1 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.6e-07 Identity = 32/98 (32.65%), Postives = 51/98 (52.04%), Query Frame = 1
BLAST of Csa6G365140 vs. Swiss-Prot
Match: NC2A_BOVIN (Dr1-associated corepressor OS=Bos taurus GN=DRAP1 PE=2 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 9.5e-07 Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Csa6G365140 vs. Swiss-Prot
Match: NC2A_HUMAN (Dr1-associated corepressor OS=Homo sapiens GN=DRAP1 PE=1 SV=3) HSP 1 Score: 54.7 bits (130), Expect = 9.5e-07 Identity = 27/75 (36.00%), Postives = 43/75 (57.33%), Query Frame = 1
BLAST of Csa6G365140 vs. TrEMBL
Match: A0A0A0KGV1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G365140 PE=4 SV=1) HSP 1 Score: 270.4 bits (690), Expect = 1.2e-69 Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
BLAST of Csa6G365140 vs. TrEMBL
Match: F6HGA3_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_01s0010g03550 PE=4 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 1.3e-42 Identity = 89/136 (65.44%), Postives = 106/136 (77.94%), Query Frame = 1
BLAST of Csa6G365140 vs. TrEMBL
Match: B9RMF4_RICCO (DNA binding protein, putative OS=Ricinus communis GN=RCOM_1080560 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 1.1e-41 Identity = 90/128 (70.31%), Postives = 106/128 (82.81%), Query Frame = 1
BLAST of Csa6G365140 vs. TrEMBL
Match: A0A0D2PU79_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G168300 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 3.5e-40 Identity = 87/131 (66.41%), Postives = 107/131 (81.68%), Query Frame = 1
BLAST of Csa6G365140 vs. TrEMBL
Match: B9GMJ4_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0001s13970g PE=4 SV=2) HSP 1 Score: 168.7 bits (426), Expect = 5.0e-39 Identity = 84/119 (70.59%), Postives = 95/119 (79.83%), Query Frame = 1
BLAST of Csa6G365140 vs. TAIR10
Match: AT5G43250.1 (AT5G43250.1 nuclear factor Y, subunit C13) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-37 Identity = 88/139 (63.31%), Postives = 100/139 (71.94%), Query Frame = 1
BLAST of Csa6G365140 vs. TAIR10
Match: AT3G48590.1 (AT3G48590.1 nuclear factor Y, subunit C1) HSP 1 Score: 57.4 bits (137), Expect = 8.3e-09 Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Csa6G365140 vs. TAIR10
Match: AT5G63470.1 (AT5G63470.1 nuclear factor Y, subunit C4) HSP 1 Score: 57.4 bits (137), Expect = 8.3e-09 Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 1
BLAST of Csa6G365140 vs. TAIR10
Match: AT3G12480.1 (AT3G12480.1 nuclear factor Y, subunit C11) HSP 1 Score: 57.0 bits (136), Expect = 1.1e-08 Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 1
BLAST of Csa6G365140 vs. TAIR10
Match: AT5G19490.1 (AT5G19490.1 Histone superfamily protein) HSP 1 Score: 55.8 bits (133), Expect = 2.4e-08 Identity = 34/105 (32.38%), Postives = 56/105 (53.33%), Query Frame = 1
BLAST of Csa6G365140 vs. NCBI nr
Match: gi|449452907|ref|XP_004144200.1| (PREDICTED: DNA polymerase epsilon subunit C [Cucumis sativus]) HSP 1 Score: 270.4 bits (690), Expect = 1.8e-69 Identity = 139/139 (100.00%), Postives = 139/139 (100.00%), Query Frame = 1
BLAST of Csa6G365140 vs. NCBI nr
Match: gi|659089430|ref|XP_008445504.1| (PREDICTED: dr1-associated corepressor [Cucumis melo]) HSP 1 Score: 249.6 bits (636), Expect = 3.2e-63 Identity = 130/137 (94.89%), Postives = 130/137 (94.89%), Query Frame = 1
BLAST of Csa6G365140 vs. NCBI nr
Match: gi|1009152915|ref|XP_015894354.1| (PREDICTED: nuclear transcription factor Y subunit gamma-like [Ziziphus jujuba]) HSP 1 Score: 183.3 bits (464), Expect = 2.8e-43 Identity = 94/127 (74.02%), Postives = 106/127 (83.46%), Query Frame = 1
BLAST of Csa6G365140 vs. NCBI nr
Match: gi|225425432|ref|XP_002271716.1| (PREDICTED: chromatin accessibility complex protein 1 [Vitis vinifera]) HSP 1 Score: 180.6 bits (457), Expect = 1.8e-42 Identity = 89/136 (65.44%), Postives = 106/136 (77.94%), Query Frame = 1
BLAST of Csa6G365140 vs. NCBI nr
Match: gi|255547732|ref|XP_002514923.1| (PREDICTED: negative cofactor 2 complex subunit alpha [Ricinus communis]) HSP 1 Score: 177.6 bits (449), Expect = 1.6e-41 Identity = 90/128 (70.31%), Postives = 106/128 (82.81%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|