Csa6G307360 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAGTTCCAATTTGAATTTTGGAGTTTTTCTATTTGGTTTTCTTTTGTCCAATAATGTCATTCCCTTGAATGCTGATACGATACTATCGAACATCGACACTTTAGCATCAAATATATGTCCACAAACCAGTAATCCATCGTTTTGTGCAAGCATATTGGAAAATGCAAACAACATAGACTTGAAAGCTTTGATCGCTTACAGCCTAAAACTTGCTCACACAAATGCAGGAAAATCTATGACTCTAGCCAAAGCACTTGCAGTACTGACAACCAATACTCTGCTTAAGAAACAATATTTGTTTTGCTTTGAGAACTACGACGAGGCGATGTGTGACATTGAAAAAGCTAAAAATGATTTGGTATTTGGTGACTATAGTGGTGTTAATCTTGCGATTTCTGATGCAATGATGATAGCTGATGACTGTCATGATAGCTTCAAACAACCGTTGAAAGATATGTCATTGCTTCCAAATAATACCAAGATGTTGAAAGACATTTATAGCATTATTTTAGTTATATCAAGTATTCTACCAAAGAATATATAA ATGATCAGTTCCAATTTGAATTTTGGAGTTTTTCTATTTGGTTTTCTTTTGTCCAATAATGTCATTCCCTTGAATGCTGATACGATACTATCGAACATCGACACTTTAGCATCAAATATATGTCCACAAACCAGTAATCCATCGTTTTGTGCAAGCATATTGGAAAATGCAAACAACATAGACTTGAAAGCTTTGATCGCTTACAGCCTAAAACTTGCTCACACAAATGCAGGAAAATCTATGACTCTAGCCAAAGCACTTGCAGTACTGACAACCAATACTCTGCTTAAGAAACAATATTTGTTTTGCTTTGAGAACTACGACGAGGCGATGTGTGACATTGAAAAAGCTAAAAATGATTTGGTATTTGGTGACTATAGTGGTGTTAATCTTGCGATTTCTGATGCAATGATGATAGCTGATGACTGTCATGATAGCTTCAAACAACCGTTGAAAGATATGTCATTGCTTCCAAATAATACCAAGATGTTGAAAGACATTTATAGCATTATTTTAGTTATATCAAGTATTCTACCAAAGAATATATAA ATGATCAGTTCCAATTTGAATTTTGGAGTTTTTCTATTTGGTTTTCTTTTGTCCAATAATGTCATTCCCTTGAATGCTGATACGATACTATCGAACATCGACACTTTAGCATCAAATATATGTCCACAAACCAGTAATCCATCGTTTTGTGCAAGCATATTGGAAAATGCAAACAACATAGACTTGAAAGCTTTGATCGCTTACAGCCTAAAACTTGCTCACACAAATGCAGGAAAATCTATGACTCTAGCCAAAGCACTTGCAGTACTGACAACCAATACTCTGCTTAAGAAACAATATTTGTTTTGCTTTGAGAACTACGACGAGGCGATGTGTGACATTGAAAAAGCTAAAAATGATTTGGTATTTGGTGACTATAGTGGTGTTAATCTTGCGATTTCTGATGCAATGATGATAGCTGATGACTGTCATGATAGCTTCAAACAACCGTTGAAAGATATGTCATTGCTTCCAAATAATACCAAGATGTTGAAAGACATTTATAGCATTATTTTAGTTATATCAAGTATTCTACCAAAGAATATATAA MISSNLNFGVFLFGFLLSNNVIPLNADTILSNIDTLASNICPQTSNPSFCASILENANNIDLKALIAYSLKLAHTNAGKSMTLAKALAVLTTNTLLKKQYLFCFENYDEAMCDIEKAKNDLVFGDYSGVNLAISDAMMIADDCHDSFKQPLKDMSLLPNNTKMLKDIYSIILVISSILPKNI*
BLAST of Csa6G307360 vs. Swiss-Prot
Match: PMEI_ACTDE (Pectinesterase inhibitor OS=Actinidia deliciosa GN=PMEI PE=1 SV=2) HSP 1 Score: 91.3 bits (225), Expect = 1.2e-17 Identity = 60/182 (32.97%), Postives = 94/182 (51.65%), Query Frame = 1
BLAST of Csa6G307360 vs. Swiss-Prot
Match: PMEI1_ARATH (Pectinesterase inhibitor 1 OS=Arabidopsis thaliana GN=PMEI1 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 3.1e-13 Identity = 51/147 (34.69%), Postives = 78/147 (53.06%), Query Frame = 1
BLAST of Csa6G307360 vs. Swiss-Prot
Match: PMEI2_ARATH (Pectinesterase inhibitor 2 OS=Arabidopsis thaliana GN=PMEI2 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 6.4e-11 Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 1
BLAST of Csa6G307360 vs. TrEMBL
Match: A0A0A0KCC4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307360 PE=4 SV=1) HSP 1 Score: 359.8 bits (922), Expect = 2.0e-96 Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 1
BLAST of Csa6G307360 vs. TrEMBL
Match: A0A0A0KEW6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307350 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 1.6e-37 Identity = 97/186 (52.15%), Postives = 124/186 (66.67%), Query Frame = 1
BLAST of Csa6G307360 vs. TrEMBL
Match: A0A0A0KCV8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307340 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 8.9e-36 Identity = 79/148 (53.38%), Postives = 104/148 (70.27%), Query Frame = 1
BLAST of Csa6G307360 vs. TrEMBL
Match: A0A0A0KHY0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G307370 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 6.0e-16 Identity = 65/187 (34.76%), Postives = 99/187 (52.94%), Query Frame = 1
BLAST of Csa6G307360 vs. TrEMBL
Match: A0A072TNA9_MEDTR (Plant invertase/pectin methylesterase inhibitor OS=Medicago truncatula GN=MTR_8g032810 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 4.3e-14 Identity = 50/146 (34.25%), Postives = 83/146 (56.85%), Query Frame = 1
BLAST of Csa6G307360 vs. TAIR10
Match: AT1G48020.1 (AT1G48020.1 pectin methylesterase inhibitor 1) HSP 1 Score: 76.6 bits (187), Expect = 1.7e-14 Identity = 51/147 (34.69%), Postives = 78/147 (53.06%), Query Frame = 1
BLAST of Csa6G307360 vs. TAIR10
Match: AT3G17220.1 (AT3G17220.1 pectin methylesterase inhibitor 2) HSP 1 Score: 68.9 bits (167), Expect = 3.6e-12 Identity = 43/145 (29.66%), Postives = 72/145 (49.66%), Query Frame = 1
BLAST of Csa6G307360 vs. TAIR10
Match: AT3G05741.1 (AT3G05741.1 Plant invertase/pectin methylesterase inhibitor superfamily protein) HSP 1 Score: 47.8 bits (112), Expect = 8.6e-06 Identity = 43/181 (23.76%), Postives = 79/181 (43.65%), Query Frame = 1
BLAST of Csa6G307360 vs. NCBI nr
Match: gi|700192171|gb|KGN47375.1| (hypothetical protein Csa_6G307360 [Cucumis sativus]) HSP 1 Score: 359.8 bits (922), Expect = 2.9e-96 Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 1
BLAST of Csa6G307360 vs. NCBI nr
Match: gi|659117597|ref|XP_008458685.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 292.0 bits (746), Expect = 7.4e-76 Identity = 150/174 (86.21%), Postives = 158/174 (90.80%), Query Frame = 1
BLAST of Csa6G307360 vs. NCBI nr
Match: gi|659117595|ref|XP_008458684.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 172.6 bits (436), Expect = 6.6e-40 Identity = 91/169 (53.85%), Postives = 119/169 (70.41%), Query Frame = 1
BLAST of Csa6G307360 vs. NCBI nr
Match: gi|659113905|ref|XP_008456811.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 169.9 bits (429), Expect = 4.2e-39 Identity = 87/154 (56.49%), Postives = 109/154 (70.78%), Query Frame = 1
BLAST of Csa6G307360 vs. NCBI nr
Match: gi|659127944|ref|XP_008463970.1| (PREDICTED: pectinesterase inhibitor-like [Cucumis melo]) HSP 1 Score: 169.1 bits (427), Expect = 7.2e-39 Identity = 88/154 (57.14%), Postives = 110/154 (71.43%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|