Csa6G303800 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAACTAATACATGATAGCAAGGTAGAAGCCATTTTAGGACCAGAAAGTTCATCACAAGCATACTTCATTGTGCAGCTTGGTGACAAAGCTGAGGTCCCTATAATTTCATTTGCACCAAAAATTTCCACTCTCTCTTATCTCAAATTTTCATACTTTTTCCGAGTCACCCAAAATCTCTCCTCCCAGGTTTACGCCATTAGTGACATCCTTAAAGTTTTCGGGTTGAGGGAAATCATTGCCGTCTACGAAGACAATAAGTTTGGAAAATGGATCGTTGCAAATCTCATTGACTCTTTGCATGTAGGTGCAAATAAGAGAAAGGAACATGTAATATACACACCATATATATACAAGGACTAA ATGGAACTAATACATGATAGCAAGGTAGAAGCCATTTTAGGACCAGAAAGTTCATCACAAGCATACTTCATTGTGCAGCTTGGTGACAAAGCTGAGGTCCCTATAATTTCATTTGCACCAAAAATTTCCACTCTCTCTTATCTCAAATTTTCATACTTTTTCCGAGTCACCCAAAATCTCTCCTCCCAGGTTTACGCCATTAGTGACATCCTTAAAGTTTTCGGGTTGAGGGAAATCATTGCCGTCTACGAAGACAATAAGTTTGGAAAATGGATCGTTGCAAATCTCATTGACTCTTTGCATGTAGGTGCAAATAAGAGAAAGGAACATGTAATATACACACCATATATATACAAGGACTAA ATGGAACTAATACATGATAGCAAGGTAGAAGCCATTTTAGGACCAGAAAGTTCATCACAAGCATACTTCATTGTGCAGCTTGGTGACAAAGCTGAGGTCCCTATAATTTCATTTGCACCAAAAATTTCCACTCTCTCTTATCTCAAATTTTCATACTTTTTCCGAGTCACCCAAAATCTCTCCTCCCAGGTTTACGCCATTAGTGACATCCTTAAAGTTTTCGGGTTGAGGGAAATCATTGCCGTCTACGAAGACAATAAGTTTGGAAAATGGATCGTTGCAAATCTCATTGACTCTTTGCATGTAGGTGCAAATAAGAGAAAGGAACATGTAATATACACACCATATATATACAAGGACTAA MELIHDSKVEAILGPESSSQAYFIVQLGDKAEVPIISFAPKISTLSYLKFSYFFRVTQNLSSQVYAISDILKVFGLREIIAVYEDNKFGKWIVANLIDSLHVGANKRKEHVIYTPYIYKD*
BLAST of Csa6G303800 vs. Swiss-Prot
Match: GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana GN=GLR2.2 PE=2 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 3.8e-20 Identity = 47/100 (47.00%), Postives = 71/100 (71.00%), Query Frame = 1
BLAST of Csa6G303800 vs. Swiss-Prot
Match: GLR24_ARATH (Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 5.0e-20 Identity = 49/100 (49.00%), Postives = 71/100 (71.00%), Query Frame = 1
BLAST of Csa6G303800 vs. Swiss-Prot
Match: GLR21_ARATH (Glutamate receptor 2.1 OS=Arabidopsis thaliana GN=GLR2.1 PE=2 SV=2) HSP 1 Score: 93.6 bits (231), Expect = 1.6e-18 Identity = 44/100 (44.00%), Postives = 72/100 (72.00%), Query Frame = 1
BLAST of Csa6G303800 vs. Swiss-Prot
Match: GLR23_ARATH (Glutamate receptor 2.3 OS=Arabidopsis thaliana GN=GLR2.3 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.8e-17 Identity = 44/100 (44.00%), Postives = 66/100 (66.00%), Query Frame = 1
BLAST of Csa6G303800 vs. Swiss-Prot
Match: GLR27_ARATH (Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3) HSP 1 Score: 88.6 bits (218), Expect = 5.1e-17 Identity = 44/100 (44.00%), Postives = 67/100 (67.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TrEMBL
Match: A0A0A0KCB4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G303800 PE=4 SV=1) HSP 1 Score: 238.4 bits (607), Expect = 4.5e-60 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TrEMBL
Match: A0A0A0KEY0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G308930 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 3.2e-42 Identity = 93/114 (81.58%), Postives = 100/114 (87.72%), Query Frame = 1
BLAST of Csa6G303800 vs. TrEMBL
Match: M5XJN6_PRUPE (Glutamate receptor OS=Prunus persica GN=PRUPE_ppa016908mg PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 1.6e-20 Identity = 51/101 (50.50%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of Csa6G303800 vs. TrEMBL
Match: A0A059CQV4_EUCGR (Uncharacterized protein (Fragment) OS=Eucalyptus grandis GN=EUGRSUZ_C019082 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.8e-19 Identity = 49/100 (49.00%), Postives = 75/100 (75.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TrEMBL
Match: A0A0A0KGS5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G361290 PE=3 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 5.0e-19 Identity = 48/100 (48.00%), Postives = 74/100 (74.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TAIR10
Match: AT2G24720.1 (AT2G24720.1 glutamate receptor 2.2) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-21 Identity = 47/100 (47.00%), Postives = 71/100 (71.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TAIR10
Match: AT4G31710.1 (AT4G31710.1 glutamate receptor 2.4) HSP 1 Score: 98.6 bits (244), Expect = 2.8e-21 Identity = 49/100 (49.00%), Postives = 71/100 (71.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TAIR10
Match: AT5G27100.1 (AT5G27100.1 glutamate receptor 2.1) HSP 1 Score: 93.6 bits (231), Expect = 9.0e-20 Identity = 44/100 (44.00%), Postives = 72/100 (72.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TAIR10
Match: AT2G24710.1 (AT2G24710.1 glutamate receptor 2.3) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-18 Identity = 44/100 (44.00%), Postives = 66/100 (66.00%), Query Frame = 1
BLAST of Csa6G303800 vs. TAIR10
Match: AT2G29120.1 (AT2G29120.1 glutamate receptor 2.7) HSP 1 Score: 88.6 bits (218), Expect = 2.9e-18 Identity = 44/100 (44.00%), Postives = 67/100 (67.00%), Query Frame = 1
BLAST of Csa6G303800 vs. NCBI nr
Match: gi|700192161|gb|KGN47365.1| (hypothetical protein Csa_6G303800 [Cucumis sativus]) HSP 1 Score: 238.4 bits (607), Expect = 6.4e-60 Identity = 120/120 (100.00%), Postives = 120/120 (100.00%), Query Frame = 1
BLAST of Csa6G303800 vs. NCBI nr
Match: gi|700192180|gb|KGN47384.1| (hypothetical protein Csa_6G308930 [Cucumis sativus]) HSP 1 Score: 179.1 bits (453), Expect = 4.6e-42 Identity = 93/114 (81.58%), Postives = 100/114 (87.72%), Query Frame = 1
BLAST of Csa6G303800 vs. NCBI nr
Match: gi|596120240|ref|XP_007221769.1| (hypothetical protein PRUPE_ppb024583mg [Prunus persica]) HSP 1 Score: 107.1 bits (266), Expect = 2.2e-20 Identity = 50/100 (50.00%), Postives = 77/100 (77.00%), Query Frame = 1
BLAST of Csa6G303800 vs. NCBI nr
Match: gi|596270040|ref|XP_007225088.1| (hypothetical protein PRUPE_ppa016908mg [Prunus persica]) HSP 1 Score: 107.1 bits (266), Expect = 2.2e-20 Identity = 51/101 (50.50%), Postives = 76/101 (75.25%), Query Frame = 1
BLAST of Csa6G303800 vs. NCBI nr
Match: gi|596290161|ref|XP_007226136.1| (hypothetical protein PRUPE_ppa014659mg [Prunus persica]) HSP 1 Score: 106.7 bits (265), Expect = 2.9e-20 Identity = 50/100 (50.00%), Postives = 77/100 (77.00%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|