Csa6G295960 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGATGTTGCACTCATGGGTCCGCTTGACCAAAAAAGGAGCCGTCCACGCCCGCCCACCACTGACATTGAAACCCAATATTGCTTTCCCATCACACCCACCTTAGTATTCTAGTTTATCTTATATTATTCGAAATATTCTCTCCAACGTACGTCCATATTAGAAAAATCAACGGGGCTCATACTCTATAAGATTGAAGGACTACTTCTCTCATTATCAATTGGTTTTGAGATAAAACCTCATACTATCAAATTTAAAAATAAGAACTACATTATAACTTTTTTTTCTAAACTATGAAATAAGTCTGCAGCAGTTCAAAACTTGAATTGGCACAATATCGCGAAGTCGCCGCCTTTGCTCAATTTGGGTCAGACCTTGATGCTGCGACTCAAGCATTACTCAATAGAGATGCAAGGCTTACAGAAGTCTCGAAACAAGCACAATATGCACCACTGAACATTGAAAAATAA ATGTTGATGTTGCACTCATGGGTCCGCTTGACCAAAAAAGGAGCCGTCCACGCCCGCCCACCACTGACATTGAAACCCAATATTGCTTTCCCATCACACCCACCTTACAGTTCAAAACTTGAATTGGCACAATATCGCGAAGTCGCCGCCTTTGCTCAATTTGGGTCAGACCTTGATGCTGCGACTCAAGCATTACTCAATAGAGATGCAAGGCTTACAGAAGTCTCGAAACAAGCACAATATGCACCACTGAACATTGAAAAATAA ATGTTGATGTTGCACTCATGGGTCCGCTTGACCAAAAAAGGAGCCGTCCACGCCCGCCCACCACTGACATTGAAACCCAATATTGCTTTCCCATCACACCCACCTTACAGTTCAAAACTTGAATTGGCACAATATCGCGAAGTCGCCGCCTTTGCTCAATTTGGGTCAGACCTTGATGCTGCGACTCAAGCATTACTCAATAGAGATGCAAGGCTTACAGAAGTCTCGAAACAAGCACAATATGCACCACTGAACATTGAAAAATAA MLMLHSWVRLTKKGAVHARPPLTLKPNIAFPSHPPYSSKLELAQYREVAAFAQFGSDLDAATQALLNRDARLTEVSKQAQYAPLNIEK*
BLAST of Csa6G295960 vs. Swiss-Prot
Match: ATPAM_RAPSA (ATP synthase subunit alpha, mitochondrial OS=Raphanus sativus GN=ATPA PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 48/52 (92.31%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa6G295960 vs. Swiss-Prot
Match: ATPAM_BRANA (ATP synthase subunit alpha, mitochondrial OS=Brassica napus GN=ATPA PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 48/52 (92.31%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa6G295960 vs. Swiss-Prot
Match: ATPAM_BRACM (ATP synthase subunit alpha, mitochondrial OS=Brassica campestris GN=ATPA PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.8e-18 Identity = 48/52 (92.31%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa6G295960 vs. Swiss-Prot
Match: ATPAM_BETVU (ATP synthase subunit alpha, mitochondrial OS=Beta vulgaris GN=ATPA PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.2e-17 Identity = 47/52 (90.38%), Postives = 45/52 (86.54%), Query Frame = 1
BLAST of Csa6G295960 vs. Swiss-Prot
Match: ATPAM_MAIZE (ATP synthase subunit alpha, mitochondrial OS=Zea mays GN=ATPA PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.2e-17 Identity = 47/52 (90.38%), Postives = 45/52 (86.54%), Query Frame = 1
BLAST of Csa6G295960 vs. TrEMBL
Match: A0A0A0KHR7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G295960 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 6.9e-42 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa6G295960 vs. TrEMBL
Match: G3EIZ8_CUCSA (ATP synthase subunit alpha OS=Cucumis sativus GN=atp1 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.3e-18 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Csa6G295960 vs. TrEMBL
Match: G3EU05_CUCME (ATP synthase subunit alpha OS=Cucumis melo subsp. melo GN=atp1 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 5.3e-18 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Csa6G295960 vs. TrEMBL
Match: A0A0A0KMP0_CUCSA (ATP synthase subunit alpha OS=Cucumis sativus GN=Csa_5G321480 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.0e-17 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 1
BLAST of Csa6G295960 vs. TrEMBL
Match: A1XIT3_LEEGU (ATP synthase subunit alpha (Fragment) OS=Leea guineensis GN=atp1 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.7e-16 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Csa6G295960 vs. TAIR10
Match: AT2G07698.1 (AT2G07698.1 ATPase, F1 complex, alpha subunit protein) HSP 1 Score: 91.3 bits (225), Expect = 3.3e-19 Identity = 48/52 (92.31%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa6G295960 vs. TAIR10
Match: ATMG01190.1 (ATMG01190.1 ATP synthase subunit 1) HSP 1 Score: 91.3 bits (225), Expect = 3.3e-19 Identity = 48/52 (92.31%), Postives = 46/52 (88.46%), Query Frame = 1
BLAST of Csa6G295960 vs. TAIR10
Match: ATCG00120.1 (ATCG00120.1 ATP synthase subunit alpha) HSP 1 Score: 58.5 bits (140), Expect = 2.4e-09 Identity = 30/50 (60.00%), Postives = 35/50 (70.00%), Query Frame = 1
BLAST of Csa6G295960 vs. NCBI nr
Match: gi|700192117|gb|KGN47321.1| (hypothetical protein Csa_6G295960 [Cucumis sativus]) HSP 1 Score: 177.6 bits (449), Expect = 9.9e-42 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa6G295960 vs. NCBI nr
Match: gi|345034443|gb|AEN56129.1| (ATPase subunit 1 [Cucumis melo subsp. melo]) HSP 1 Score: 98.2 bits (243), Expect = 7.6e-18 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Csa6G295960 vs. NCBI nr
Match: gi|346683384|ref|YP_004849346.1| (ATPase subunit 1 [Cucumis sativus]) HSP 1 Score: 98.2 bits (243), Expect = 7.6e-18 Identity = 51/52 (98.08%), Postives = 51/52 (98.08%), Query Frame = 1
BLAST of Csa6G295960 vs. NCBI nr
Match: gi|778708462|ref|XP_011656203.1| (PREDICTED: LOW QUALITY PROTEIN: ATP synthase subunit alpha, mitochondrial [Cucumis sativus]) HSP 1 Score: 96.3 bits (238), Expect = 2.9e-17 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 1
BLAST of Csa6G295960 vs. NCBI nr
Match: gi|700195733|gb|KGN50910.1| (hypothetical protein Csa_5G321480 [Cucumis sativus]) HSP 1 Score: 96.3 bits (238), Expect = 2.9e-17 Identity = 50/51 (98.04%), Postives = 50/51 (98.04%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |