Csa6G199280 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTTGGTAGCAAAAATGGCTGCAAAGAAAGCGGTAGTGATCTTTAGCAAGAGTACATGTTGCATGTGTCATGCAATCGAAAGGTTGTTCTACGATCAAGGAGCGAGTCCGGAGATTCACGAGCTCGATCGGGAGTCGAAAGGGAAGGAAATGGAGTCTGCCCTCTCGAAGACGTTGGGGGGTTGCAGCCCAACCGTGCCAGTTGTGTTCATCGGTGGAAAGCTTATCGGATCCGCCAACACTGTCATGACTCTTCATCTCAATGGTTCCCTAAAAAAATTGCTAAAGGAAGCAGGAGCTATATGGCTTTGATGTTTTGAACATAAATTATTAGTAGAATTGAACAAAAGGTCTCTTTTTTTGATCCTTTTGTGTAAAA ATGGACTTGGTAGCAAAAATGGCTGCAAAGAAAGCGGTAGTGATCTTTAGCAAGAGTACATGTTGCATGTGTCATGCAATCGAAAGGTTGTTCTACGATCAAGGAGCGAGTCCGGAGATTCACGAGCTCGATCGGGAGTCGAAAGGGAAGGAAATGGAGTCTGCCCTCTCGAAGACGTTGGGGGGTTGCAGCCCAACCGTGCCAGTTGTGTTCATCGGTGGAAAGCTTATCGGATCCGCCAACACTGTCATGACTCTTCATCTCAATGGTTCCCTAAAAAAATTGCTAAAGGAAGCAGGAGCTATATGGCTTTGA ATGGACTTGGTAGCAAAAATGGCTGCAAAGAAAGCGGTAGTGATCTTTAGCAAGAGTACATGTTGCATGTGTCATGCAATCGAAAGGTTGTTCTACGATCAAGGAGCGAGTCCGGAGATTCACGAGCTCGATCGGGAGTCGAAAGGGAAGGAAATGGAGTCTGCCCTCTCGAAGACGTTGGGGGGTTGCAGCCCAACCGTGCCAGTTGTGTTCATCGGTGGAAAGCTTATCGGATCCGCCAACACTGTCATGACTCTTCATCTCAATGGTTCCCTAAAAAAATTGCTAAAGGAAGCAGGAGCTATATGGCTTTGA MDLVAKMAAKKAVVIFSKSTCCMCHAIERLFYDQGASPEIHELDRESKGKEMESALSKTLGGCSPTVPVVFIGGKLIGSANTVMTLHLNGSLKKLLKEAGAIWL*
BLAST of Csa6G199280 vs. Swiss-Prot
Match: GRS10_ARATH (Monothiol glutaredoxin-S10 OS=Arabidopsis thaliana GN=GRXS10 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 5.6e-36 Identity = 72/104 (69.23%), Postives = 89/104 (85.58%), Query Frame = 1
BLAST of Csa6G199280 vs. Swiss-Prot
Match: GRC11_ARATH (Glutaredoxin-C11 OS=Arabidopsis thaliana GN=GRXC11 PE=3 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.3e-29 Identity = 58/104 (55.77%), Postives = 82/104 (78.85%), Query Frame = 1
BLAST of Csa6G199280 vs. Swiss-Prot
Match: GRXS3_ARATH (Monothiol glutaredoxin-S3 OS=Arabidopsis thaliana GN=GRXS3 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 3.0e-29 Identity = 63/104 (60.58%), Postives = 80/104 (76.92%), Query Frame = 1
BLAST of Csa6G199280 vs. Swiss-Prot
Match: GRXS4_ARATH (Monothiol glutaredoxin-S4 OS=Arabidopsis thaliana GN=GRXS4 PE=3 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 5.1e-29 Identity = 62/104 (59.62%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of Csa6G199280 vs. Swiss-Prot
Match: GRC14_ORYSJ (Putative glutaredoxin-C14 OS=Oryza sativa subsp. japonica GN=GRXC14 PE=3 SV=2) HSP 1 Score: 127.5 bits (319), Expect = 8.7e-29 Identity = 61/104 (58.65%), Postives = 76/104 (73.08%), Query Frame = 1
BLAST of Csa6G199280 vs. TrEMBL
Match: A0A0A0KHF0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G199280 PE=4 SV=1) HSP 1 Score: 209.5 bits (532), Expect = 1.9e-51 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of Csa6G199280 vs. TrEMBL
Match: B9MZY7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s22890g PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 2.1e-37 Identity = 79/104 (75.96%), Postives = 92/104 (88.46%), Query Frame = 1
BLAST of Csa6G199280 vs. TrEMBL
Match: B9RT13_RICCO (Glutaredoxin, grx, putative OS=Ricinus communis GN=RCOM_0680270 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 4.6e-37 Identity = 77/104 (74.04%), Postives = 92/104 (88.46%), Query Frame = 1
BLAST of Csa6G199280 vs. TrEMBL
Match: D7T6I0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_05s0020g01760 PE=4 SV=1) HSP 1 Score: 161.4 bits (407), Expect = 6.0e-37 Identity = 78/104 (75.00%), Postives = 91/104 (87.50%), Query Frame = 1
BLAST of Csa6G199280 vs. TrEMBL
Match: A0A067KV30_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_02010 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 1.0e-36 Identity = 77/104 (74.04%), Postives = 91/104 (87.50%), Query Frame = 1
BLAST of Csa6G199280 vs. TAIR10
Match: AT3G21460.1 (AT3G21460.1 Glutaredoxin family protein) HSP 1 Score: 151.4 bits (381), Expect = 3.2e-37 Identity = 72/104 (69.23%), Postives = 89/104 (85.58%), Query Frame = 1
BLAST of Csa6G199280 vs. TAIR10
Match: AT3G62950.1 (AT3G62950.1 Thioredoxin superfamily protein) HSP 1 Score: 130.2 bits (326), Expect = 7.5e-31 Identity = 58/104 (55.77%), Postives = 82/104 (78.85%), Query Frame = 1
BLAST of Csa6G199280 vs. TAIR10
Match: AT4G15700.1 (AT4G15700.1 Thioredoxin superfamily protein) HSP 1 Score: 129.0 bits (323), Expect = 1.7e-30 Identity = 63/104 (60.58%), Postives = 80/104 (76.92%), Query Frame = 1
BLAST of Csa6G199280 vs. TAIR10
Match: AT4G15680.1 (AT4G15680.1 Thioredoxin superfamily protein) HSP 1 Score: 128.3 bits (321), Expect = 2.9e-30 Identity = 62/104 (59.62%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of Csa6G199280 vs. TAIR10
Match: AT4G15670.1 (AT4G15670.1 Thioredoxin superfamily protein) HSP 1 Score: 125.9 bits (315), Expect = 1.4e-29 Identity = 60/104 (57.69%), Postives = 79/104 (75.96%), Query Frame = 1
BLAST of Csa6G199280 vs. NCBI nr
Match: gi|449466195|ref|XP_004150812.1| (PREDICTED: monothiol glutaredoxin-S10 [Cucumis sativus]) HSP 1 Score: 209.5 bits (532), Expect = 2.8e-51 Identity = 104/104 (100.00%), Postives = 104/104 (100.00%), Query Frame = 1
BLAST of Csa6G199280 vs. NCBI nr
Match: gi|659117210|ref|XP_008458480.1| (PREDICTED: monothiol glutaredoxin-S10 [Cucumis melo]) HSP 1 Score: 200.3 bits (508), Expect = 1.7e-48 Identity = 101/104 (97.12%), Postives = 103/104 (99.04%), Query Frame = 1
BLAST of Csa6G199280 vs. NCBI nr
Match: gi|566185448|ref|XP_006380203.1| (hypothetical protein POPTR_0008s22890g [Populus trichocarpa]) HSP 1 Score: 162.9 bits (411), Expect = 3.0e-37 Identity = 79/104 (75.96%), Postives = 92/104 (88.46%), Query Frame = 1
BLAST of Csa6G199280 vs. NCBI nr
Match: gi|1000971383|ref|XP_015573300.1| (PREDICTED: monothiol glutaredoxin-S10 [Ricinus communis]) HSP 1 Score: 161.8 bits (408), Expect = 6.6e-37 Identity = 77/104 (74.04%), Postives = 92/104 (88.46%), Query Frame = 1
BLAST of Csa6G199280 vs. NCBI nr
Match: gi|731388864|ref|XP_010649773.1| (PREDICTED: monothiol glutaredoxin-S10 [Vitis vinifera]) HSP 1 Score: 161.4 bits (407), Expect = 8.7e-37 Identity = 78/104 (75.00%), Postives = 91/104 (87.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|