Csa6G105150 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCTCAAACACAATCTCATTTACCAACAAAATATTTGAAGATGGATTTCAAGAAACTCAGTGTTCTGTGAAGGGAGAAACCAGCAATATAATAATGGAGGAAAGAAGATCACAATCACATGAAGTTTTAAGGAAAGGGCCATGGAAACTCGAAGAAGATGAAGTACTTTTGAACCATGTTAACCGTTTCGGTCCCAGAGACTGGAGCTCCATTCGATCCAAAGGCCTTCTTCAGCGGACTGGCAAGTCCTGCCGTCTTCGTTGGGTTAATAAACTCAGACCCAACTTGAAAAAGTAA ATGGAGGAAAGAAGATCACAATCACATGAAGTTTTAAGGAAAGGGCCATGGAAACTCGAAGAAGATGAAGTACTTTTGAACCATGTTAACCGTTTCGGTCCCAGAGACTGGAGCTCCATTCGATCCAAAGGCCTTCTTCAGCGGACTGGCAAGTCCTGCCGTCTTCGTTGGGTTAATAAACTCAGACCCAACTTGAAAAAGTAA ATGGAGGAAAGAAGATCACAATCACATGAAGTTTTAAGGAAAGGGCCATGGAAACTCGAAGAAGATGAAGTACTTTTGAACCATGTTAACCGTTTCGGTCCCAGAGACTGGAGCTCCATTCGATCCAAAGGCCTTCTTCAGCGGACTGGCAAGTCCTGCCGTCTTCGTTGGGTTAATAAACTCAGACCCAACTTGAAAAAGTAA MEERRSQSHEVLRKGPWKLEEDEVLLNHVNRFGPRDWSSIRSKGLLQRTGKSCRLRWVNKLRPNLKK*
BLAST of Csa6G105150 vs. Swiss-Prot
Match: MYB40_ANTMA (Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 5.6e-13 Identity = 32/68 (47.06%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Csa6G105150 vs. Swiss-Prot
Match: MYB86_ARATH (Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.6e-12 Identity = 34/56 (60.71%), Postives = 38/56 (67.86%), Query Frame = 1
BLAST of Csa6G105150 vs. Swiss-Prot
Match: MYB05_ANTMA (Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 3.7e-12 Identity = 31/68 (45.59%), Postives = 47/68 (69.12%), Query Frame = 1
BLAST of Csa6G105150 vs. Swiss-Prot
Match: MYB21_ARATH (Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 6.2e-12 Identity = 29/62 (46.77%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of Csa6G105150 vs. Swiss-Prot
Match: MYB24_ARATH (Transcription factor MYB24 OS=Arabidopsis thaliana GN=MYB24 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.1e-11 Identity = 28/56 (50.00%), Postives = 40/56 (71.43%), Query Frame = 1
BLAST of Csa6G105150 vs. TrEMBL
Match: A0A0A0K9Z0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G105150 PE=4 SV=1) HSP 1 Score: 143.3 bits (360), Expect = 1.1e-31 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa6G105150 vs. TrEMBL
Match: A0A151RAV2_CAJCA (Transcription factor GAMYB OS=Cajanus cajan GN=KK1_038912 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.2e-24 Identity = 53/66 (80.30%), Postives = 58/66 (87.88%), Query Frame = 1
BLAST of Csa6G105150 vs. TrEMBL
Match: A0A087GZE9_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA5G260400 PE=4 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 6.5e-24 Identity = 53/66 (80.30%), Postives = 58/66 (87.88%), Query Frame = 1
BLAST of Csa6G105150 vs. TrEMBL
Match: A0A0D3CUY6_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea GN=DUO1 PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.4e-23 Identity = 51/58 (87.93%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of Csa6G105150 vs. TrEMBL
Match: A0A078BUD3_BRANA (BnaA07g18670D protein OS=Brassica napus GN=BnaA07g18670D PE=4 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.4e-23 Identity = 51/58 (87.93%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of Csa6G105150 vs. TAIR10
Match: AT3G60460.1 (AT3G60460.1 myb-like HTH transcriptional regulator family protein) HSP 1 Score: 113.2 bits (282), Expect = 6.2e-26 Identity = 50/57 (87.72%), Postives = 52/57 (91.23%), Query Frame = 1
BLAST of Csa6G105150 vs. TAIR10
Match: AT4G26930.1 (AT4G26930.1 myb domain protein 97) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 32/57 (56.14%), Postives = 39/57 (68.42%), Query Frame = 1
BLAST of Csa6G105150 vs. TAIR10
Match: AT3G48920.1 (AT3G48920.1 myb domain protein 45) HSP 1 Score: 73.6 bits (179), Expect = 5.4e-14 Identity = 37/64 (57.81%), Postives = 42/64 (65.62%), Query Frame = 1
BLAST of Csa6G105150 vs. TAIR10
Match: AT5G06100.2 (AT5G06100.2 myb domain protein 33) HSP 1 Score: 73.6 bits (179), Expect = 5.4e-14 Identity = 30/56 (53.57%), Postives = 40/56 (71.43%), Query Frame = 1
BLAST of Csa6G105150 vs. TAIR10
Match: AT5G26660.1 (AT5G26660.1 myb domain protein 86) HSP 1 Score: 72.8 bits (177), Expect = 9.3e-14 Identity = 34/56 (60.71%), Postives = 38/56 (67.86%), Query Frame = 1
BLAST of Csa6G105150 vs. NCBI nr
Match: gi|700191306|gb|KGN46510.1| (hypothetical protein Csa_6G105150 [Cucumis sativus]) HSP 1 Score: 143.3 bits (360), Expect = 1.6e-31 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa6G105150 vs. NCBI nr
Match: gi|449445734|ref|XP_004140627.1| (PREDICTED: myb-related protein Myb4-like [Cucumis sativus]) HSP 1 Score: 141.4 bits (355), Expect = 6.0e-31 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa6G105150 vs. NCBI nr
Match: gi|659119692|ref|XP_008459792.1| (PREDICTED: myb-related protein 308-like [Cucumis melo]) HSP 1 Score: 140.2 bits (352), Expect = 1.3e-30 Identity = 65/66 (98.48%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa6G105150 vs. NCBI nr
Match: gi|1012328109|gb|KYP39774.1| (Transcription factor GAMYB [Cajanus cajan]) HSP 1 Score: 119.0 bits (297), Expect = 3.2e-24 Identity = 53/66 (80.30%), Postives = 58/66 (87.88%), Query Frame = 1
BLAST of Csa6G105150 vs. NCBI nr
Match: gi|702354868|ref|XP_010058514.1| (PREDICTED: transcription factor MYB82 [Eucalyptus grandis]) HSP 1 Score: 118.6 bits (296), Expect = 4.2e-24 Identity = 52/66 (78.79%), Postives = 60/66 (90.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|