Csa5G626020 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTCATTTTGTAACATGTTCATGTAAGCTCTTAAAAAAGAATCTAGTTTCTTCTTCTTTCTCCAGGCAGCCGACAACCCCCTCCCATATCACCTATTATCTCGTTCATTCCACCGCACGTTCCTCTCGCCGGAAGCGCTGAACGCCGTCGAAACCGAAGCCTAACCACAGCCGCGCTACTCAATTCGTCGTCCAGCTCACGCGCACTCGAGATCTGAAGTTGCGGGCTTCGAAATTTGTTGTTCTTCGTCCCTTCTCCGACGCCCAAACGGTATCCGCCGAGCACGCCACCGCCCGACTAACACTCACGCTACCTCGTGAAAATCGCTCGCGCTACGGTTGGATATGAAGTTGTAGCGGTCGGATCTCACCACTTGAACCCGAGTCTTGATAATACAAGACAAGACGCTTCTTATTGTGGCTACATTGCAACCTGCGGCGTGTAGCTGCTGACTGTCTTAAAATGTTCAAAAATACGTTTCAGTCCGGATTTCTGTCTATATTATTCAGCCTTGGGTATGTTTAGGTGTTTCGAAACCAGTGCTTACGGTCTGTCAAATGTTTTGCCTTTTAAATTCCTAGGATTAATGATCTGATCTGTTATTTAATATTTGTTTTTTTTATAGGAGCAAACCTCTCCAGATATGGGATAAAGAAGGTGAGTGTTTTCGTTATCGAGATGCGGTTTTTATTTTGCATTTGATTAAAGATTCTCTTGTCTGTTTGGTATTTGAGTACACGGCTATTAAGTTCTTGAATGGTCTGAAATTAGGGATTTTTCCGGGGTGGGGACAGTGA ATGTTCAAAAATACGTTTCAGTCCGGATTTCTGTCTATATTATTCAGCCTTGGGAGCAAACCTCTCCAGATATGGGATAAAGAAGGTGAGTGTTTTCGTTATCGAGATGCGGTTTTTATTTTGCATTTGATTAAAGATTCTCTTGTCTGTTTGGTATTTGAGTACACGGCTATTAAGTTCTTGAATGGTCTGAAATTAGGGATTTTTCCGGGGTGGGGACAGTGA ATGTTCAAAAATACGTTTCAGTCCGGATTTCTGTCTATATTATTCAGCCTTGGGAGCAAACCTCTCCAGATATGGGATAAAGAAGGTGAGTGTTTTCGTTATCGAGATGCGGTTTTTATTTTGCATTTGATTAAAGATTCTCTTGTCTGTTTGGTATTTGAGTACACGGCTATTAAGTTCTTGAATGGTCTGAAATTAGGGATTTTTCCGGGGTGGGGACAGTGA MFKNTFQSGFLSILFSLGSKPLQIWDKEGECFRYRDAVFILHLIKDSLVCLVFEYTAIKFLNGLKLGIFPGWGQ*
BLAST of Csa5G626020 vs. Swiss-Prot
Match: CFA20_BOVIN (Cilia- and flagella-associated protein 20 OS=Bos taurus GN=CFAP20 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-08 Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. Swiss-Prot
Match: CFA20_DANRE (Cilia- and flagella-associated protein 20 OS=Danio rerio GN=cfap20 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-08 Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. Swiss-Prot
Match: CFA20_HUMAN (Cilia- and flagella-associated protein 20 OS=Homo sapiens GN=CFAP20 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-08 Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. Swiss-Prot
Match: CFA20_MOUSE (Cilia- and flagella-associated protein 20 OS=Mus musculus GN=Cfap20 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-08 Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. Swiss-Prot
Match: CFA20_RAT (Cilia- and flagella-associated protein 20 OS=Rattus norvegicus GN=Cfap20 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.9e-08 Identity = 25/28 (89.29%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. TrEMBL
Match: A0A0A0KV68_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G626020 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.1e-35 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. TrEMBL
Match: A0A103Y1D6_CYNCS (Uncharacterized protein (Fragment) OS=Cynara cardunculus var. scolymus GN=Ccrd_021001 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.1e-07 Identity = 28/30 (93.33%), Postives = 30/30 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. TrEMBL
Match: M5WWV2_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa016200mg PE=4 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.6e-07 Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. TrEMBL
Match: A0A0D3AEA6_BRAOL (Uncharacterized protein OS=Brassica oleracea var. oleracea PE=4 SV=1) HSP 1 Score: 61.2 bits (147), Expect = 6.1e-07 Identity = 32/48 (66.67%), Postives = 36/48 (75.00%), Query Frame = 1
BLAST of Csa5G626020 vs. TrEMBL
Match: V4M1U2_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10021577mg PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.0e-06 Identity = 28/30 (93.33%), Postives = 29/30 (96.67%), Query Frame = 1
BLAST of Csa5G626020 vs. TAIR10
Match: AT3G12300.1 (AT3G12300.1 unknown protein) HSP 1 Score: 59.7 bits (143), Expect = 8.9e-10 Identity = 27/28 (96.43%), Postives = 26/28 (92.86%), Query Frame = 1
BLAST of Csa5G626020 vs. NCBI nr
Match: gi|700197165|gb|KGN52342.1| (hypothetical protein Csa_5G626020 [Cucumis sativus]) HSP 1 Score: 156.8 bits (395), Expect = 1.5e-35 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. NCBI nr
Match: gi|778706935|ref|XP_011655943.1| (PREDICTED: cilia- and flagella-associated protein 20 isoform X1 [Cucumis sativus]) HSP 1 Score: 77.4 bits (189), Expect = 1.2e-11 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. NCBI nr
Match: gi|659092267|ref|XP_008446984.1| (PREDICTED: UPF0468 protein C16orf80 homolog isoform X1 [Cucumis melo]) HSP 1 Score: 73.2 bits (178), Expect = 2.2e-10 Identity = 34/35 (97.14%), Postives = 34/35 (97.14%), Query Frame = 1
BLAST of Csa5G626020 vs. NCBI nr
Match: gi|976914615|gb|KVI00746.1| (hypothetical protein Ccrd_021001, partial [Cynara cardunculus var. scolymus]) HSP 1 Score: 62.8 bits (151), Expect = 3.0e-07 Identity = 28/30 (93.33%), Postives = 30/30 (100.00%), Query Frame = 1
BLAST of Csa5G626020 vs. NCBI nr
Match: gi|595882636|ref|XP_007212634.1| (hypothetical protein PRUPE_ppa016200mg, partial [Prunus persica]) HSP 1 Score: 62.0 bits (149), Expect = 5.1e-07 Identity = 28/29 (96.55%), Postives = 29/29 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|