Csa5G598790 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAGAGATAGCGGCGTGGTGTTTGAATGAAAATCCGGTGGGGAGACCGGAGATGCGTGAAATTGTTGCTTTGCTGTCGCAGCTTATGACCTCCGCCGTCGAATGGGAAGCCTCACTCGGCGGTAACAGCCAGGTTTTCAGTGGCCTCTTCACCGGAAGATGA ATGGGAGAGATAGCGGCGTGGTGTTTGAATGAAAATCCGGTGGGGAGACCGGAGATGCGTGAAATTGTTGCTTTGCTGTCGCAGCTTATGACCTCCGCCGTCGAATGGGAAGCCTCACTCGGCGGTAACAGCCAGGTTTTCAGTGGCCTCTTCACCGGAAGATGA ATGGGAGAGATAGCGGCGTGGTGTTTGAATGAAAATCCGGTGGGGAGACCGGAGATGCGTGAAATTGTTGCTTTGCTGTCGCAGCTTATGACCTCCGCCGTCGAATGGGAAGCCTCACTCGGCGGTAACAGCCAGGTTTTCAGTGGCCTCTTCACCGGAAGATGA MGEIAAWCLNENPVGRPEMREIVALLSQLMTSAVEWEASLGGNSQVFSGLFTGR*
BLAST of Csa5G598790 vs. Swiss-Prot
Match: LYK3_ARATH (LysM domain receptor-like kinase 3 OS=Arabidopsis thaliana GN=LYK3 PE=2 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 3.6e-10 Identity = 27/51 (52.94%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Csa5G598790 vs. TrEMBL
Match: A0A0A0KVJ0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G598790 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 2.2e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G598790 vs. TrEMBL
Match: M5XHD0_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa019853mg PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.4e-15 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of Csa5G598790 vs. TrEMBL
Match: B9SPJ3_RICCO (Serine-threonine protein kinase, plant-type, putative OS=Ricinus communis GN=RCOM_0024500 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 4.4e-15 Identity = 39/54 (72.22%), Postives = 47/54 (87.04%), Query Frame = 1
BLAST of Csa5G598790 vs. TrEMBL
Match: A0A067GU95_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g044997mg PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 3.8e-14 Identity = 38/54 (70.37%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of Csa5G598790 vs. TrEMBL
Match: V4TDX4_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10033617mg PE=3 SV=1) HSP 1 Score: 84.7 bits (208), Expect = 3.8e-14 Identity = 38/54 (70.37%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of Csa5G598790 vs. TAIR10
Match: AT1G51940.1 (AT1G51940.1 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein) HSP 1 Score: 64.7 bits (156), Expect = 2.0e-11 Identity = 27/51 (52.94%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Csa5G598790 vs. NCBI nr
Match: gi|778708647|ref|XP_011656254.1| (PREDICTED: lysM domain receptor-like kinase 3 [Cucumis sativus]) HSP 1 Score: 112.1 bits (279), Expect = 3.2e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G598790 vs. NCBI nr
Match: gi|700196594|gb|KGN51771.1| (hypothetical protein Csa_5G598790 [Cucumis sativus]) HSP 1 Score: 112.1 bits (279), Expect = 3.2e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G598790 vs. NCBI nr
Match: gi|659092312|ref|XP_008447006.1| (PREDICTED: lysM domain receptor-like kinase 3 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 3.2e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1
BLAST of Csa5G598790 vs. NCBI nr
Match: gi|645230546|ref|XP_008221984.1| (PREDICTED: lysM domain receptor-like kinase 3 [Prunus mume]) HSP 1 Score: 87.8 bits (216), Expect = 6.4e-15 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 1
BLAST of Csa5G598790 vs. NCBI nr
Match: gi|596232251|ref|XP_007224308.1| (hypothetical protein PRUPE_ppa019853mg [Prunus persica]) HSP 1 Score: 87.8 bits (216), Expect = 6.4e-15 Identity = 40/54 (74.07%), Postives = 46/54 (85.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |