Csa5G593370 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGAAAGAAGAAAACTGGGGTATTCAGATATGCTGATTGGTTGGATCAGTTGCTAATGTTTCTTGGTTGCTTGGGGAGTATTGGAGATGGGCTTACAACTCCACTCACTATGCTTGTTCTAAGTGGTATGATCAATCACTATTCTGTTTCTGATTCCAACTCTTTTTCAAATCATGTTGTGGACAAGGTAATTTCTTTATTATTACTTTCTATACTTATAATAGTTTCTTCCATTGGAATTTACTGGTTGTGGTTGTAA ATGGGAAAGAAGAAAACTGGGGTATTCAGATATGCTGATTGGTTGGATCAGTTGCTAATGTTTCTTGGTTGCTTGGGGAGTATTGGAGATGGGCTTACAACTCCACTCACTATGCTTGTTCTAAGTGGTATGATCAATCACTATTCTGTTTCTGATTCCAACTCTTTTTCAAATCATGTTGTGGACAAGGTAATTTCTTTATTATTACTTTCTATACTTATAATAGTTTCTTCCATTGGAATTTACTGGTTGTGGTTGTAA ATGGGAAAGAAGAAAACTGGGGTATTCAGATATGCTGATTGGTTGGATCAGTTGCTAATGTTTCTTGGTTGCTTGGGGAGTATTGGAGATGGGCTTACAACTCCACTCACTATGCTTGTTCTAAGTGGTATGATCAATCACTATTCTGTTTCTGATTCCAACTCTTTTTCAAATCATGTTGTGGACAAGGTAATTTCTTTATTATTACTTTCTATACTTATAATAGTTTCTTCCATTGGAATTTACTGGTTGTGGTTGTAA MGKKKTGVFRYADWLDQLLMFLGCLGSIGDGLTTPLTMLVLSGMINHYSVSDSNSFSNHVVDKVISLLLLSILIIVSSIGIYWLWL*
BLAST of Csa5G593370 vs. Swiss-Prot
Match: AB8B_ARATH (Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 7.7e-07 Identity = 23/77 (29.87%), Postives = 48/77 (62.34%), Query Frame = 1
BLAST of Csa5G593370 vs. Swiss-Prot
Match: AB15B_ARATH (ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 8.6e-06 Identity = 25/66 (37.88%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of Csa5G593370 vs. TrEMBL
Match: A0A0A0KS41_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G593370 PE=4 SV=1) HSP 1 Score: 174.9 bits (442), Expect = 4.4e-41 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of Csa5G593370 vs. TrEMBL
Match: A0A067JVB0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17871 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.3e-12 Identity = 44/79 (55.70%), Postives = 52/79 (65.82%), Query Frame = 1
BLAST of Csa5G593370 vs. TrEMBL
Match: A0A067JVB0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_17871 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.6e-12 Identity = 44/75 (58.67%), Postives = 50/75 (66.67%), Query Frame = 1
HSP 2 Score: 77.8 bits (190), Expect = 7.3e-12 Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 1
BLAST of Csa5G593370 vs. TrEMBL
Match: A0A0D2Q8R0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G188900 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-11 Identity = 38/83 (45.78%), Postives = 54/83 (65.06%), Query Frame = 1
BLAST of Csa5G593370 vs. TrEMBL
Match: W9RMX8_9ROSA (ABC transporter B family member 15 OS=Morus notabilis GN=L484_027646 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 1.2e-11 Identity = 44/71 (61.97%), Postives = 49/71 (69.01%), Query Frame = 1
BLAST of Csa5G593370 vs. TAIR10
Match: AT3G28345.1 (AT3G28345.1 ABC transporter family protein) HSP 1 Score: 50.8 bits (120), Expect = 4.8e-07 Identity = 25/66 (37.88%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of Csa5G593370 vs. TAIR10
Match: AT3G28380.1 (AT3G28380.1 P-glycoprotein 17) HSP 1 Score: 50.1 bits (118), Expect = 8.2e-07 Identity = 22/66 (33.33%), Postives = 40/66 (60.61%), Query Frame = 1
BLAST of Csa5G593370 vs. NCBI nr
Match: gi|700196547|gb|KGN51724.1| (hypothetical protein Csa_5G593370 [Cucumis sativus]) HSP 1 Score: 174.9 bits (442), Expect = 6.3e-41 Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = 1
BLAST of Csa5G593370 vs. NCBI nr
Match: gi|449435440|ref|XP_004135503.1| (PREDICTED: ABC transporter B family member 15-like [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.2e-28 Identity = 67/81 (82.72%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Csa5G593370 vs. NCBI nr
Match: gi|659090647|ref|XP_008446126.1| (PREDICTED: putative multidrug resistance protein [Cucumis melo]) HSP 1 Score: 125.9 bits (315), Expect = 3.3e-26 Identity = 61/75 (81.33%), Postives = 67/75 (89.33%), Query Frame = 1
BLAST of Csa5G593370 vs. NCBI nr
Match: gi|694357674|ref|XP_009359349.1| (PREDICTED: putative multidrug resistance protein [Pyrus x bretschneideri]) HSP 1 Score: 80.9 bits (198), Expect = 1.2e-12 Identity = 47/83 (56.63%), Postives = 59/83 (71.08%), Query Frame = 1
BLAST of Csa5G593370 vs. NCBI nr
Match: gi|645230591|ref|XP_008222004.1| (PREDICTED: LOW QUALITY PROTEIN: putative multidrug resistance protein [Prunus mume]) HSP 1 Score: 79.3 bits (194), Expect = 3.6e-12 Identity = 46/85 (54.12%), Postives = 60/85 (70.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |