Csa5G590180 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTTAGATGGTGGTCTGTCCTGGGCAGATCAATGGGATTACAACCCTGACCCCCCACCATCGTCATCGGAAAATGAGAAGAAGAAGAACAAAGATGGATCTTCAGACAAGAGCAAATTTAGGAAGACAATCTTGGGCTTCAAGTGGATGAAAGAATTGCGAAAGAAATCTGACAAATCTTGA ATGGGTTTAGATGGTGGTCTGTCCTGGGCAGATCAATGGGATTACAACCCTGACCCCCCACCATCGTCATCGGAAAATGAGAAGAAGAAGAACAAAGATGGATCTTCAGACAAGAGCAAATTTAGGAAGACAATCTTGGGCTTCAAGTGGATGAAAGAATTGCGAAAGAAATCTGACAAATCTTGA ATGGGTTTAGATGGTGGTCTGTCCTGGGCAGATCAATGGGATTACAACCCTGACCCCCCACCATCGTCATCGGAAAATGAGAAGAAGAAGAACAAAGATGGATCTTCAGACAAGAGCAAATTTAGGAAGACAATCTTGGGCTTCAAGTGGATGAAAGAATTGCGAAAGAAATCTGACAAATCTTGA MGLDGGLSWADQWDYNPDPPPSSSENEKKKNKDGSSDKSKFRKTILGFKWMKELRKKSDKS*
BLAST of Csa5G590180 vs. TrEMBL
Match: A0A0A0KVC1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G590180 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 8.0e-29 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa5G590180 vs. TrEMBL
Match: A0A151SP79_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_002802 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.5e-15 Identity = 41/58 (70.69%), Postives = 49/58 (84.48%), Query Frame = 1
BLAST of Csa5G590180 vs. TrEMBL
Match: W9RC84_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_027584 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.5e-15 Identity = 39/58 (67.24%), Postives = 47/58 (81.03%), Query Frame = 1
BLAST of Csa5G590180 vs. TrEMBL
Match: A0A087HQU8_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA1G265100 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 6.5e-15 Identity = 40/61 (65.57%), Postives = 47/61 (77.05%), Query Frame = 1
BLAST of Csa5G590180 vs. TrEMBL
Match: A0A0D2T1I4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G163100 PE=4 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 3.2e-14 Identity = 35/58 (60.34%), Postives = 46/58 (79.31%), Query Frame = 1
BLAST of Csa5G590180 vs. TAIR10
Match: AT1G67670.1 (AT1G67670.1 unknown protein) HSP 1 Score: 80.5 bits (197), Expect = 4.0e-16 Identity = 42/66 (63.64%), Postives = 47/66 (71.21%), Query Frame = 1
BLAST of Csa5G590180 vs. TAIR10
Match: AT1G24405.1 (AT1G24405.1 unknown protein) HSP 1 Score: 77.0 bits (188), Expect = 4.5e-15 Identity = 39/62 (62.90%), Postives = 41/62 (66.13%), Query Frame = 1
BLAST of Csa5G590180 vs. NCBI nr
Match: gi|449435454|ref|XP_004135510.1| (PREDICTED: uncharacterized protein LOC101219061 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 1.1e-28 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa5G590180 vs. NCBI nr
Match: gi|659090574|ref|XP_008446089.1| (PREDICTED: uncharacterized protein LOC103488917 [Cucumis melo]) HSP 1 Score: 130.2 bits (326), Expect = 1.3e-27 Identity = 58/61 (95.08%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa5G590180 vs. NCBI nr
Match: gi|729410753|ref|XP_010556172.1| (PREDICTED: uncharacterized protein LOC104825525 [Tarenaya hassleriana]) HSP 1 Score: 95.9 bits (237), Expect = 2.6e-17 Identity = 49/60 (81.67%), Postives = 51/60 (85.00%), Query Frame = 1
BLAST of Csa5G590180 vs. NCBI nr
Match: gi|1009153039|ref|XP_015894420.1| (PREDICTED: uncharacterized protein LOC107428400 [Ziziphus jujuba]) HSP 1 Score: 87.4 bits (215), Expect = 9.4e-15 Identity = 41/59 (69.49%), Postives = 47/59 (79.66%), Query Frame = 1
BLAST of Csa5G590180 vs. NCBI nr
Match: gi|674251735|gb|KFK44500.1| (hypothetical protein AALP_AA1G265100 [Arabis alpina]) HSP 1 Score: 87.4 bits (215), Expect = 9.4e-15 Identity = 40/61 (65.57%), Postives = 47/61 (77.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |