Csa5G515040 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTACAAAATGGAAAGTCTTAGTTATTATTGAAGAAGATGAATTGTTATTTATTGTTAGATATTGTCCTACGTTTTGTTGGCGGGAGCAGCGGCGGCGTTGGGTTCAAGCATAGATTTGAAGGCGAATATGAGCGAATGGAGCTCGTTTTTTGACCAAGGCAATGCAGCTGCTGCGCTTCTTCTTCTTGCATTTTTATGTAGTGCTATCATTTCTGTACTTTCTTCTTTAGCTCTTTCTAACAAACCTAATTAG ATGATATTGTCCTACGTTTTGTTGGCGGGAGCAGCGGCGGCGTTGGGTTCAAGCATAGATTTGAAGGCGAATATGAGCGAATGGAGCTCGTTTTTTGACCAAGGCAATGCAGCTGCTGCGCTTCTTCTTCTTGCATTTTTATGTAGTGCTATCATTTCTGTACTTTCTTCTTTAGCTCTTTCTAACAAACCTAATTAG ATGATATTGTCCTACGTTTTGTTGGCGGGAGCAGCGGCGGCGTTGGGTTCAAGCATAGATTTGAAGGCGAATATGAGCGAATGGAGCTCGTTTTTTGACCAAGGCAATGCAGCTGCTGCGCTTCTTCTTCTTGCATTTTTATGTAGTGCTATCATTTCTGTACTTTCTTCTTTAGCTCTTTCTAACAAACCTAATTAG MILSYVLLAGAAAALGSSIDLKANMSEWSSFFDQGNAAAALLLLAFLCSAIISVLSSLALSNKPN*
BLAST of Csa5G515040 vs. Swiss-Prot
Match: CSPLL_POPTR (CASP-like protein 4D1 OS=Populus trichocarpa GN=POPTR_0010s21230g PE=2 SV=2) HSP 1 Score: 59.7 bits (143), Expect = 1.4e-08 Identity = 31/64 (48.44%), Postives = 44/64 (68.75%), Query Frame = 1
BLAST of Csa5G515040 vs. Swiss-Prot
Match: CSPLE_RICCO (CASP-like protein 4D1 OS=Ricinus communis GN=RCOM_1206790 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 2.6e-07 Identity = 27/62 (43.55%), Postives = 43/62 (69.35%), Query Frame = 1
BLAST of Csa5G515040 vs. Swiss-Prot
Match: CSPLK_ARALL (CASP-like protein 4D1 OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_903205 PE=3 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 3.4e-07 Identity = 34/72 (47.22%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of Csa5G515040 vs. Swiss-Prot
Match: CSPLC_ARATH (CASP-like protein 4D1 OS=Arabidopsis thaliana GN=At2g39530 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.9e-07 Identity = 33/72 (45.83%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of Csa5G515040 vs. Swiss-Prot
Match: CSPLC_SOYBN (CASP-like protein 4D1 OS=Glycine max PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.0e-06 Identity = 27/62 (43.55%), Postives = 42/62 (67.74%), Query Frame = 1
BLAST of Csa5G515040 vs. TrEMBL
Match: A0A0A0KQW8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G515040 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.1e-25 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 1
BLAST of Csa5G515040 vs. TrEMBL
Match: A0A0A0KS88_CUCSA (CASP-like protein OS=Cucumis sativus GN=Csa_5G515020 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.5e-13 Identity = 41/69 (59.42%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of Csa5G515040 vs. TrEMBL
Match: A0A0A0KNU7_CUCSA (CASP-like protein OS=Cucumis sativus GN=Csa_5G515030 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-10 Identity = 37/65 (56.92%), Postives = 53/65 (81.54%), Query Frame = 1
BLAST of Csa5G515040 vs. TrEMBL
Match: D7TLT6_VITVI (CASP-like protein OS=Vitis vinifera GN=VIT_13s0019g01390 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-08 Identity = 35/62 (56.45%), Postives = 46/62 (74.19%), Query Frame = 1
BLAST of Csa5G515040 vs. TrEMBL
Match: A0A0D2UY23_GOSRA (CASP-like protein OS=Gossypium raimondii GN=B456_011G257400 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.4e-07 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 1
BLAST of Csa5G515040 vs. TAIR10
Match: AT2G39530.1 (AT2G39530.1 Uncharacterised protein family (UPF0497)) HSP 1 Score: 54.3 bits (129), Expect = 3.3e-08 Identity = 33/72 (45.83%), Postives = 44/72 (61.11%), Query Frame = 1
BLAST of Csa5G515040 vs. TAIR10
Match: AT2G39518.1 (AT2G39518.1 Uncharacterised protein family (UPF0497)) HSP 1 Score: 48.5 bits (114), Expect = 1.8e-06 Identity = 26/71 (36.62%), Postives = 39/71 (54.93%), Query Frame = 1
BLAST of Csa5G515040 vs. NCBI nr
Match: gi|700196122|gb|KGN51299.1| (hypothetical protein Csa_5G515040 [Cucumis sativus]) HSP 1 Score: 123.2 bits (308), Expect = 1.6e-25 Identity = 65/65 (100.00%), Postives = 65/65 (100.00%), Query Frame = 1
BLAST of Csa5G515040 vs. NCBI nr
Match: gi|659117979|ref|XP_008458887.1| (PREDICTED: CASP-like protein RCOM_1206790 [Cucumis melo]) HSP 1 Score: 108.2 bits (269), Expect = 5.5e-21 Identity = 57/64 (89.06%), Postives = 60/64 (93.75%), Query Frame = 1
BLAST of Csa5G515040 vs. NCBI nr
Match: gi|449450002|ref|XP_004142753.1| (PREDICTED: CASP-like protein 4D1 [Cucumis sativus]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 41/69 (59.42%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of Csa5G515040 vs. NCBI nr
Match: gi|659117983|ref|XP_008458889.1| (PREDICTED: CASP-like protein RCOM_1206790 [Cucumis melo]) HSP 1 Score: 75.1 bits (183), Expect = 5.1e-11 Identity = 37/69 (53.62%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of Csa5G515040 vs. NCBI nr
Match: gi|700196121|gb|KGN51298.1| (hypothetical protein Csa_5G515030 [Cucumis sativus]) HSP 1 Score: 73.6 bits (179), Expect = 1.5e-10 Identity = 37/65 (56.92%), Postives = 53/65 (81.54%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |