Csa5G453720 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTAGGGAACAACGATTCTAGTGCAAGAATCTTTTTCTAACTTTCATTCTCAATTTCTGCATCAGTCTGTCCAAGTTTTTCCTTCCATGAGAGTTACTGATTTCAGAAACCAATCAGATGGGGCTCGGATTTGAAATTTGGATAGCTTTATTATAGGTTAATTTGTATGACGCGGTTTCTTGTGAAAAGTATGAGGCAGTTGAAGAAGTTAAATGACTTGTGGTGGTAGTAATCATTGTCAAACTCATGTGGTTTTTAACTTAAAAAGAAAGAGGGAAAATGTGAACTTAGTCCTATGCAGATTAGTGTTTTAAAGAGGAAAAATATGAGCTTAGTCCGATGCAAATGAGTGTTTTAAGTCTTCTATCTAATTGTTCGTGGGATAAATGCAGTTACTTTATCAAAAACAAAGAAGAAAAGGAAGGGACCACAAGAAATCAATGGTGGAATCGATCAGGCAGGGTGTGGAAAATTACAACTCAGTTTTTGTTTTCACTGTTGAGAACATGAGAAACCTCAAGTTCAAGGAACTCAGGGAGCAGCTGAAGTCAGCTAGCAGGCAAGTTCTACTTTCTGAATTCTGTATTATTTAA ATGGTAGGGAACAACGATTCTAGTTTACTTTATCAAAAACAAAGAAGAAAAGGAAGGGACCACAAGAAATCAATGGTGGAATCGATCAGGCAGGGTGTGGAAAATTACAACTCAGTTTTTGTTTTCACTGTTGAGAACATGAGAAACCTCAAGTTCAAGGAACTCAGGGAGCAGCTGAAGTCAGCTAGCAGGCAAGTTCTACTTTCTGAATTCTGTATTATTTAA ATGGTAGGGAACAACGATTCTAGTTTACTTTATCAAAAACAAAGAAGAAAAGGAAGGGACCACAAGAAATCAATGGTGGAATCGATCAGGCAGGGTGTGGAAAATTACAACTCAGTTTTTGTTTTCACTGTTGAGAACATGAGAAACCTCAAGTTCAAGGAACTCAGGGAGCAGCTGAAGTCAGCTAGCAGGCAAGTTCTACTTTCTGAATTCTGTATTATTTAA MVGNNDSSLLYQKQRRKGRDHKKSMVESIRQGVENYNSVFVFTVENMRNLKFKELREQLKSASRQVLLSEFCII*
BLAST of Csa5G453720 vs. TrEMBL
Match: A0A0A0KNA7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G453720 PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 8.4e-33 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa5G453720 vs. TrEMBL
Match: A0A0A0LM77_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G302060 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.5e-13 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 1
BLAST of Csa5G453720 vs. TrEMBL
Match: A0A118K137_CYNCS (Ribosomal protein L10/acidic P0 OS=Cynara cardunculus var. scolymus GN=Ccrd_019959 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 3.3e-13 Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of Csa5G453720 vs. TrEMBL
Match: D7T050_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_12s0034g01000 PE=3 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.7e-12 Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = 1
BLAST of Csa5G453720 vs. TrEMBL
Match: A0A067LGD2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_16917 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.3e-12 Identity = 35/52 (67.31%), Postives = 45/52 (86.54%), Query Frame = 1
BLAST of Csa5G453720 vs. TAIR10
Match: AT1G25260.1 (AT1G25260.1 Ribosomal protein L10 family protein) HSP 1 Score: 66.2 bits (160), Expect = 9.6e-12 Identity = 28/55 (50.91%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of Csa5G453720 vs. NCBI nr
Match: gi|700195938|gb|KGN51115.1| (hypothetical protein Csa_5G453720 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.2e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa5G453720 vs. NCBI nr
Match: gi|778670193|ref|XP_011649395.1| (PREDICTED: mRNA turnover protein 4 homolog [Cucumis sativus]) HSP 1 Score: 95.1 bits (235), Expect = 5.4e-17 Identity = 47/59 (79.66%), Postives = 50/59 (84.75%), Query Frame = 1
BLAST of Csa5G453720 vs. NCBI nr
Match: gi|700207020|gb|KGN62139.1| (hypothetical protein Csa_2G302060 [Cucumis sativus]) HSP 1 Score: 83.2 bits (204), Expect = 2.1e-13 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 1
BLAST of Csa5G453720 vs. NCBI nr
Match: gi|976916231|gb|KVI01756.1| (Ribosomal protein L10/acidic P0 [Cynara cardunculus var. scolymus]) HSP 1 Score: 82.0 bits (201), Expect = 4.8e-13 Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 1
BLAST of Csa5G453720 vs. NCBI nr
Match: gi|225448095|ref|XP_002276595.1| (PREDICTED: mRNA turnover protein 4 homolog [Vitis vinifera]) HSP 1 Score: 79.7 bits (195), Expect = 2.4e-12 Identity = 37/59 (62.71%), Postives = 47/59 (79.66%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|