Csa5G158590 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.TAACGAAGAAGAATGTGCTGGACAGTTTGAATTGGGTGACAGTAATAATGCCATGGAGTTTTACCCATTTGGATATGGCAAAAGATCATGTGCAGGGATCGCATTGGCCGAGAGGATGCTGATGTTCATATTGGCATCTTTGCTGCATTCTTTCGAGTGGGAATTGCCTAAGGATTCAGTGATTGATTTTAAAGAGAAATTTGGAATTGTCAATAAGAAGTTGAATCCTTTGGTTGCTATTCCTACGCCATCACTCTCCAATTCGGACCTTTACTTGGCCTAAAATAAGGGATCATTAGTTATATTATAGTTTGGGTATGTGATTCTATGTTGTAGCTAGCTTTCTAAAAGACTAGTAGTCGGTCCTTACTGTATGCTAGAAAATTTGGCAAACTTGAAAAGATGTATGGCCATGTTGGGAAAATGAATAAAAAATCGTTTTTAGTTTTTA ATGGAGTTTTACCCATTTGGATATGGCAAAAGATCATGTGCAGGGATCGCATTGGCCGAGAGGATGCTGATGTTCATATTGGCATCTTTGCTGCATTCTTTCGAGTGGGAATTGCCTAAGGATTCAGTGATTGATTTTAAAGAGAAATTTGGAATTGTCAATAAGAAGTTGAATCCTTTGGTTGCTATTCCTACGCCATCACTCTCCAATTCGGACCTTTACTTGGCCTAA ATGGAGTTTTACCCATTTGGATATGGCAAAAGATCATGTGCAGGGATCGCATTGGCCGAGAGGATGCTGATGTTCATATTGGCATCTTTGCTGCATTCTTTCGAGTGGGAATTGCCTAAGGATTCAGTGATTGATTTTAAAGAGAAATTTGGAATTGTCAATAAGAAGTTGAATCCTTTGGTTGCTATTCCTACGCCATCACTCTCCAATTCGGACCTTTACTTGGCCTAA MEFYPFGYGKRSCAGIALAERMLMFILASLLHSFEWELPKDSVIDFKEKFGIVNKKLNPLVAIPTPSLSNSDLYLA*
BLAST of Csa5G158590 vs. Swiss-Prot
Match: C76M8_ORYSJ (Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-11 Identity = 35/67 (52.24%), Postives = 42/67 (62.69%), Query Frame = 1
BLAST of Csa5G158590 vs. Swiss-Prot
Match: C76M6_ORYSJ (Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.1e-11 Identity = 35/69 (50.72%), Postives = 40/69 (57.97%), Query Frame = 1
BLAST of Csa5G158590 vs. Swiss-Prot
Match: C76M7_ORYSJ (Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.5e-11 Identity = 34/66 (51.52%), Postives = 41/66 (62.12%), Query Frame = 1
BLAST of Csa5G158590 vs. Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.0e-11 Identity = 36/74 (48.65%), Postives = 47/74 (63.51%), Query Frame = 1
BLAST of Csa5G158590 vs. Swiss-Prot
Match: C76BA_SWEMU (Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.7e-10 Identity = 35/70 (50.00%), Postives = 45/70 (64.29%), Query Frame = 1
BLAST of Csa5G158590 vs. TrEMBL
Match: A0A0A0KKR9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G158590 PE=3 SV=1) HSP 1 Score: 156.0 bits (393), Expect = 1.9e-35 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of Csa5G158590 vs. TrEMBL
Match: A0A067FN54_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g009492mg PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.0e-22 Identity = 53/73 (72.60%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of Csa5G158590 vs. TrEMBL
Match: V4TFX9_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10014862mg PE=3 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 4.0e-22 Identity = 53/73 (72.60%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of Csa5G158590 vs. TrEMBL
Match: V4W0D6_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10014863mg PE=3 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 5.3e-22 Identity = 52/73 (71.23%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of Csa5G158590 vs. TrEMBL
Match: V4U071_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017773mg PE=3 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 9.0e-22 Identity = 53/73 (72.60%), Postives = 60/73 (82.19%), Query Frame = 1
BLAST of Csa5G158590 vs. TAIR10
Match: AT4G12320.1 (AT4G12320.1 cytochrome P450, family 706, subfamily A, polypeptide 6) HSP 1 Score: 103.2 bits (256), Expect = 7.2e-23 Identity = 46/73 (63.01%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of Csa5G158590 vs. TAIR10
Match: AT4G12300.1 (AT4G12300.1 cytochrome P450, family 706, subfamily A, polypeptide 4) HSP 1 Score: 99.0 bits (245), Expect = 1.4e-21 Identity = 44/73 (60.27%), Postives = 58/73 (79.45%), Query Frame = 1
BLAST of Csa5G158590 vs. TAIR10
Match: AT4G12310.1 (AT4G12310.1 cytochrome P450, family 706, subfamily A, polypeptide 5) HSP 1 Score: 96.7 bits (239), Expect = 6.8e-21 Identity = 44/72 (61.11%), Postives = 54/72 (75.00%), Query Frame = 1
BLAST of Csa5G158590 vs. TAIR10
Match: AT4G22690.1 (AT4G22690.1 cytochrome P450, family 706, subfamily A, polypeptide 1) HSP 1 Score: 85.5 bits (210), Expect = 1.6e-17 Identity = 39/75 (52.00%), Postives = 53/75 (70.67%), Query Frame = 1
BLAST of Csa5G158590 vs. TAIR10
Match: AT4G22710.1 (AT4G22710.1 cytochrome P450, family 706, subfamily A, polypeptide 2) HSP 1 Score: 85.5 bits (210), Expect = 1.6e-17 Identity = 39/75 (52.00%), Postives = 53/75 (70.67%), Query Frame = 1
BLAST of Csa5G158590 vs. NCBI nr
Match: gi|449459750|ref|XP_004147609.1| (PREDICTED: 7-ethoxycoumarin O-deethylase-like [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 2.7e-35 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of Csa5G158590 vs. NCBI nr
Match: gi|700195026|gb|KGN50203.1| (hypothetical protein Csa_5G158590 [Cucumis sativus]) HSP 1 Score: 156.0 bits (393), Expect = 2.7e-35 Identity = 76/76 (100.00%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of Csa5G158590 vs. NCBI nr
Match: gi|659073592|ref|XP_008437145.1| (PREDICTED: 7-ethoxycoumarin O-deethylase-like [Cucumis melo]) HSP 1 Score: 152.1 bits (383), Expect = 3.9e-34 Identity = 72/76 (94.74%), Postives = 76/76 (100.00%), Query Frame = 1
BLAST of Csa5G158590 vs. NCBI nr
Match: gi|985471481|ref|XP_015381264.1| (PREDICTED: uncharacterized protein LOC102630520 [Citrus sinensis]) HSP 1 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 53/73 (72.60%), Postives = 61/73 (83.56%), Query Frame = 1
BLAST of Csa5G158590 vs. NCBI nr
Match: gi|985471481|ref|XP_015381264.1| (PREDICTED: uncharacterized protein LOC102630520 [Citrus sinensis]) HSP 1 Score: 84.7 bits (208), Expect = 7.6e-14 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 1
HSP 2 Score: 111.7 bits (278), Expect = 5.8e-22 Identity = 53/73 (72.60%), Postives = 61/73 (83.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |