Csa5G155430 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCTGCCTCTCCCAGAGGGCAGCGGCAAAGAACTTAGTTCTGGTCAGGCTTGGAATTTCGATGTGAGACCTGGCACTGCCGGAGCTCGTGTTTGGGCTCGAACCAACTGCAACTTCGATGCCTCTGGACGCGGCCATTTTGAAACTGGAGACTGCGGTGGCCTCCTCTCTTGTCAAGGTTATTAA ATGCTGCCTCTCCCAGAGGGCAGCGGCAAAGAACTTAGTTCTGGTCAGGCTTGGAATTTCGATGTGAGACCTGGCACTGCCGGAGCTCGTGTTTGGGCTCGAACCAACTGCAACTTCGATGCCTCTGGACGCGGCCATTTTGAAACTGGAGACTGCGGTGGCCTCCTCTCTTGTCAAGGTTATTAA ATGCTGCCTCTCCCAGAGGGCAGCGGCAAAGAACTTAGTTCTGGTCAGGCTTGGAATTTCGATGTGAGACCTGGCACTGCCGGAGCTCGTGTTTGGGCTCGAACCAACTGCAACTTCGATGCCTCTGGACGCGGCCATTTTGAAACTGGAGACTGCGGTGGCCTCCTCTCTTGTCAAGGTTATTAA MLPLPEGSGKELSSGQAWNFDVRPGTAGARVWARTNCNFDASGRGHFETGDCGGLLSCQGY*
BLAST of Csa5G155430 vs. Swiss-Prot
Match: PRR2_TOBAC (Pathogenesis-related protein R minor form OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.1e-18 Identity = 36/55 (65.45%), Postives = 43/55 (78.18%), Query Frame = 1
BLAST of Csa5G155430 vs. Swiss-Prot
Match: ALL13_OLEEU (Thaumatin-like protein OS=Olea europaea PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.1e-18 Identity = 37/55 (67.27%), Postives = 40/55 (72.73%), Query Frame = 1
BLAST of Csa5G155430 vs. Swiss-Prot
Match: PRR1_TOBAC (Pathogenesis-related protein R major form OS=Nicotiana tabacum PE=1 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 6.9e-18 Identity = 36/55 (65.45%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of Csa5G155430 vs. Swiss-Prot
Match: P21_SOYBN (Protein P21 OS=Glycine max PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-16 Identity = 36/58 (62.07%), Postives = 42/58 (72.41%), Query Frame = 1
BLAST of Csa5G155430 vs. Swiss-Prot
Match: TLP1_MANZA (Thaumatin-like protein 1 OS=Manilkara zapota GN=TLP1 PE=1 SV=2) HSP 1 Score: 82.8 bits (203), Expect = 1.4e-15 Identity = 33/55 (60.00%), Postives = 37/55 (67.27%), Query Frame = 1
BLAST of Csa5G155430 vs. TrEMBL
Match: A0A0A0KNZ4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G155430 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 9.4e-30 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa5G155430 vs. TrEMBL
Match: K4DFX0_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 2.7e-16 Identity = 38/55 (69.09%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of Csa5G155430 vs. TrEMBL
Match: Q5XUG9_SOLTU (Putative thaumatin-like protein OS=Solanum tuberosum GN=PR-5/319 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 3.5e-16 Identity = 38/55 (69.09%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of Csa5G155430 vs. TrEMBL
Match: A0A0A0KKB7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G155460 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.5e-16 Identity = 39/55 (70.91%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of Csa5G155430 vs. TrEMBL
Match: L7TRX5_ACTCH (Thaumatin-like protein OS=Actinidia chinensis GN=TLP4 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 5.9e-16 Identity = 38/55 (69.09%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of Csa5G155430 vs. TAIR10
Match: AT4G11650.1 (AT4G11650.1 osmotin 34) HSP 1 Score: 79.0 bits (193), Expect = 1.2e-15 Identity = 32/55 (58.18%), Postives = 37/55 (67.27%), Query Frame = 1
BLAST of Csa5G155430 vs. TAIR10
Match: AT1G19320.1 (AT1G19320.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 60.5 bits (145), Expect = 4.3e-10 Identity = 30/52 (57.69%), Postives = 31/52 (59.62%), Query Frame = 1
BLAST of Csa5G155430 vs. TAIR10
Match: AT1G75050.1 (AT1G75050.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 9.7e-10 Identity = 27/58 (46.55%), Postives = 32/58 (55.17%), Query Frame = 1
BLAST of Csa5G155430 vs. TAIR10
Match: AT5G24620.1 (AT5G24620.1 Pathogenesis-related thaumatin superfamily protein) HSP 1 Score: 58.2 bits (139), Expect = 2.2e-09 Identity = 30/58 (51.72%), Postives = 33/58 (56.90%), Query Frame = 1
BLAST of Csa5G155430 vs. TAIR10
Match: AT1G75030.1 (AT1G75030.1 thaumatin-like protein 3) HSP 1 Score: 57.8 bits (138), Expect = 2.8e-09 Identity = 27/58 (46.55%), Postives = 31/58 (53.45%), Query Frame = 1
BLAST of Csa5G155430 vs. NCBI nr
Match: gi|700194955|gb|KGN50132.1| (hypothetical protein Csa_5G155430 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 1.3e-29 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1
BLAST of Csa5G155430 vs. NCBI nr
Match: gi|659073735|ref|XP_008437223.1| (PREDICTED: protein P21-like [Cucumis melo]) HSP 1 Score: 114.0 bits (284), Expect = 9.4e-23 Identity = 51/55 (92.73%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of Csa5G155430 vs. NCBI nr
Match: gi|723751925|ref|XP_010314485.1| (PREDICTED: pathogenesis-related protein R major form [Solanum lycopersicum]) HSP 1 Score: 92.0 bits (227), Expect = 3.8e-16 Identity = 38/55 (69.09%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of Csa5G155430 vs. NCBI nr
Match: gi|131017|sp|P07052.1|PRR2_TOBAC (RecName: Full=Pathogenesis-related protein R minor form; Short=PR-R; AltName: Full=PROB12; AltName: Full=Thaumatin-like protein E2; Flags: Precursor [Nicotiana tabacum]) HSP 1 Score: 91.7 bits (226), Expect = 5.0e-16 Identity = 36/55 (65.45%), Postives = 45/55 (81.82%), Query Frame = 1
BLAST of Csa5G155430 vs. NCBI nr
Match: gi|565397058|ref|XP_006364119.1| (PREDICTED: pathogenesis-related protein R major form [Solanum tuberosum]) HSP 1 Score: 91.7 bits (226), Expect = 5.0e-16 Identity = 38/55 (69.09%), Postives = 41/55 (74.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |