Csa4G622240 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.GAAGAGAGAAGAGAAGTAAGAGAACTGAAAACCCCAAAGTTCAGTTAATTGAGATTTACAAAGATGTCGTATGTTGTAGATACGATTTCAAATCGCATAGTAATGATAATCAGTTTCGTTTTATTGTTAGTATTATTAATATTGGGATGGAAAATAGTTGATTGGATTTGGTTCCGCCCGAAGAAACTAGAGAAGCTTTTAAGACGGCAAGGATTCACCGGAAATTCATACCGGATTCTCCACGGCGACTTGAAGGAGAGTGCCGCCATGAGAAAGGAAGCAATGTCCAAGCCCATGAACTTCTCCAATCATATTGCTCCACGTGTCATTCCCTCTGTCTATCATACCATCCAAATTTATGGTAAACACTTTATCCCCAACATTTCCTTCTCATCCTTTTCTTCTTCTTCAAATAAGATTTAA ATGTCGTATGTTGTAGATACGATTTCAAATCGCATAGTAATGATAATCAGTTTCGTTTTATTGTTAGTATTATTAATATTGGGATGGAAAATAGTTGATTGGATTTGGTTCCGCCCGAAGAAACTAGAGAAGCTTTTAAGACGGCAAGGATTCACCGGAAATTCATACCGGATTCTCCACGGCGACTTGAAGGAGAGTGCCGCCATGAGAAAGGAAGCAATGTCCAAGCCCATGAACTTCTCCAATCATATTGCTCCACGTGTCATTCCCTCTGTCTATCATACCATCCAAATTTATGGTAAACACTTTATCCCCAACATTTCCTTCTCATCCTTTTCTTCTTCTTCAAATAAGATTTAA ATGTCGTATGTTGTAGATACGATTTCAAATCGCATAGTAATGATAATCAGTTTCGTTTTATTGTTAGTATTATTAATATTGGGATGGAAAATAGTTGATTGGATTTGGTTCCGCCCGAAGAAACTAGAGAAGCTTTTAAGACGGCAAGGATTCACCGGAAATTCATACCGGATTCTCCACGGCGACTTGAAGGAGAGTGCCGCCATGAGAAAGGAAGCAATGTCCAAGCCCATGAACTTCTCCAATCATATTGCTCCACGTGTCATTCCCTCTGTCTATCATACCATCCAAATTTATGGTAAACACTTTATCCCCAACATTTCCTTCTCATCCTTTTCTTCTTCTTCAAATAAGATTTAA MSYVVDTISNRIVMIISFVLLLVLLILGWKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPRVIPSVYHTIQIYGKHFIPNISFSSFSSSSNKI*
BLAST of Csa4G622240 vs. Swiss-Prot
Match: C72A1_CATRO (Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 4.0e-22 Identity = 50/102 (49.02%), Postives = 66/102 (64.71%), Query Frame = 1
BLAST of Csa4G622240 vs. Swiss-Prot
Match: C7A29_PANGI (Cytochrome P450 CYP72A219 OS=Panax ginseng PE=2 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.3e-22 Identity = 47/89 (52.81%), Postives = 61/89 (68.54%), Query Frame = 1
BLAST of Csa4G622240 vs. Swiss-Prot
Match: C72C1_ARATH (Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2) HSP 1 Score: 92.8 bits (229), Expect = 2.7e-18 Identity = 42/98 (42.86%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of Csa4G622240 vs. Swiss-Prot
Match: C7A11_ARATH (Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 4.8e-15 Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 1
BLAST of Csa4G622240 vs. Swiss-Prot
Match: C7A15_ARATH (Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 2.4e-14 Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 1
BLAST of Csa4G622240 vs. TrEMBL
Match: A0A0A0L1Y2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G622240 PE=4 SV=1) HSP 1 Score: 240.0 bits (611), Expect = 1.5e-60 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
BLAST of Csa4G622240 vs. TrEMBL
Match: A0A0A0KZE8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G621220 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 3.1e-37 Identity = 76/102 (74.51%), Postives = 91/102 (89.22%), Query Frame = 1
BLAST of Csa4G622240 vs. TrEMBL
Match: A0A0A0KZF1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G622740 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 1.5e-36 Identity = 79/102 (77.45%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Csa4G622240 vs. TrEMBL
Match: A0A0A0KZZ2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G622230 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 1.3e-35 Identity = 75/88 (85.23%), Postives = 82/88 (93.18%), Query Frame = 1
BLAST of Csa4G622240 vs. TrEMBL
Match: A0A0A0M1P6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G574240 PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 1.0e-24 Identity = 55/88 (62.50%), Postives = 69/88 (78.41%), Query Frame = 1
BLAST of Csa4G622240 vs. TAIR10
Match: AT1G17060.1 (AT1G17060.1 cytochrome p450 72c1) HSP 1 Score: 92.8 bits (229), Expect = 1.5e-19 Identity = 42/98 (42.86%), Postives = 67/98 (68.37%), Query Frame = 1
BLAST of Csa4G622240 vs. TAIR10
Match: AT3G14630.1 (AT3G14630.1 cytochrome P450, family 72, subfamily A, polypeptide 9) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-16 Identity = 38/90 (42.22%), Postives = 56/90 (62.22%), Query Frame = 1
BLAST of Csa4G622240 vs. TAIR10
Match: AT3G14610.1 (AT3G14610.1 cytochrome P450, family 72, subfamily A, polypeptide 7) HSP 1 Score: 82.8 bits (203), Expect = 1.6e-16 Identity = 37/85 (43.53%), Postives = 52/85 (61.18%), Query Frame = 1
BLAST of Csa4G622240 vs. TAIR10
Match: AT3G14650.1 (AT3G14650.1 cytochrome P450, family 72, subfamily A, polypeptide 11) HSP 1 Score: 82.0 bits (201), Expect = 2.7e-16 Identity = 34/75 (45.33%), Postives = 48/75 (64.00%), Query Frame = 1
BLAST of Csa4G622240 vs. TAIR10
Match: AT3G14690.1 (AT3G14690.1 cytochrome P450, family 72, subfamily A, polypeptide 15) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-15 Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 1
BLAST of Csa4G622240 vs. NCBI nr
Match: gi|700199856|gb|KGN55014.1| (hypothetical protein Csa_4G622240 [Cucumis sativus]) HSP 1 Score: 240.0 bits (611), Expect = 2.2e-60 Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 1
BLAST of Csa4G622240 vs. NCBI nr
Match: gi|778697794|ref|XP_011654406.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis sativus]) HSP 1 Score: 205.7 bits (522), Expect = 4.6e-50 Identity = 101/102 (99.02%), Postives = 102/102 (100.00%), Query Frame = 1
BLAST of Csa4G622240 vs. NCBI nr
Match: gi|659103032|ref|XP_008452438.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]) HSP 1 Score: 171.8 bits (434), Expect = 7.3e-40 Identity = 84/101 (83.17%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Csa4G622240 vs. NCBI nr
Match: gi|659103030|ref|XP_008452437.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]) HSP 1 Score: 171.8 bits (434), Expect = 7.3e-40 Identity = 84/102 (82.35%), Postives = 93/102 (91.18%), Query Frame = 1
BLAST of Csa4G622240 vs. NCBI nr
Match: gi|659103028|ref|XP_008452436.1| (PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]) HSP 1 Score: 165.6 bits (418), Expect = 5.3e-38 Identity = 80/102 (78.43%), Postives = 93/102 (91.18%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|