Csa4G619050 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAAAGATACAAATTGACATGGAAATTGAACAAAAGATTCTCAAACAATAACCATCAAAAGTGGAAAAGTATTATTGTAATTTATTTTGCTAGTAGATTTGTTTTCTGGAACAGACTCTGTGAGCTTCAATCGCAAAAAAGATGAGGATGATTCTTATGAAGTGACACTTGATGATGATTTTCTTACAGCTCTGGAATATGGAATGCCACCAGCTTCTGGACTGGTATGCTTATCTTTTCTGTCTGTCCACTTTTCTGTATCACATTTTGGATGGGATCCTTGATGCACTGCTAGTGAAACTCTAGATCACTCCATTCTTTTGACATAATAAAATCACAGAAAAAATAGATTAGAAAGTGGCCAATAAAAGTATCTTGAATAGCTATTTCATAGCTGCTCTGAAGTTTTTCCACATGCAAAACATTTAAAAACCAGCTGCTGAAGTCTCCAATGTGCAAGCTGAGTAGTCTAAAATTTTCAAGTGCATACAAAATTACCGAATCTGGGGCTGGTATTTGATCTATAATTAAATTGTGGAACACATGATGGATGTTTTGTTGTACTTGGATGTTTAGTATCCCCTTTCCTCGCTGTAACTGATTAAAGAATTTAACTTTCAGGGAATTGGAATTGATAGATTAGTGATGCTTCTGACAAACTCTGCAAGCATTCGAGATGTAATTGATACATGA ATGAAAAAAAGATACAAATTGACATGGAAATTGAACAAAAGATTCTCAAACAATAACCATCAAAAGTGGAAAAACTCTGTGAGCTTCAATCGCAAAAAAGATGAGGATGATTCTTATGAAGTGACACTTGATGATGATTTTCTTACAGCTCTGGAATATGGAATGCCACCAGCTTCTGGACTGGGAATTGGAATTGATAGATTAGTGATGCTTCTGACAAACTCTGCAAGCATTCGAGATGTAATTGATACATGA ATGAAAAAAAGATACAAATTGACATGGAAATTGAACAAAAGATTCTCAAACAATAACCATCAAAAGTGGAAAAACTCTGTGAGCTTCAATCGCAAAAAAGATGAGGATGATTCTTATGAAGTGACACTTGATGATGATTTTCTTACAGCTCTGGAATATGGAATGCCACCAGCTTCTGGACTGGGAATTGGAATTGATAGATTAGTGATGCTTCTGACAAACTCTGCAAGCATTCGAGATGTAATTGATACATGA MKKRYKLTWKLNKRFSNNNHQKWKNSVSFNRKKDEDDSYEVTLDDDFLTALEYGMPPASGLGIGIDRLVMLLTNSASIRDVIDT*
BLAST of Csa4G619050 vs. Swiss-Prot
Match: SYKM_ARATH (Lysine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA5 PE=2 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 1.1e-18 Identity = 44/52 (84.62%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Csa4G619050 vs. Swiss-Prot
Match: SYK_ANAVT (Lysine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lysS PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.1e-13 Identity = 38/51 (74.51%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Csa4G619050 vs. Swiss-Prot
Match: SYK_NOSS1 (Lysine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lysS PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.1e-13 Identity = 38/51 (74.51%), Postives = 39/51 (76.47%), Query Frame = 1
BLAST of Csa4G619050 vs. Swiss-Prot
Match: SYK_PELTS (Lysine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lysS PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.1e-13 Identity = 36/52 (69.23%), Postives = 43/52 (82.69%), Query Frame = 1
BLAST of Csa4G619050 vs. Swiss-Prot
Match: SYK_GEOSE (Lysine--tRNA ligase OS=Geobacillus stearothermophilus GN=lysS PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.2e-12 Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of Csa4G619050 vs. TrEMBL
Match: A0A0A0L4F7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G619050 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 5.6e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. TrEMBL
Match: A0A0A0L1N3_CUCSA (Lysine--tRNA ligase OS=Cucumis sativus GN=Csa_4G268050 PE=3 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.2e-23 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. TrEMBL
Match: V7AP93_PHAVU (Lysine--tRNA ligase OS=Phaseolus vulgaris GN=PHAVU_010G046400g PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 2.1e-19 Identity = 52/68 (76.47%), Postives = 59/68 (86.76%), Query Frame = 1
BLAST of Csa4G619050 vs. TrEMBL
Match: A0A0S3SVH1_PHAAN (Lysine--tRNA ligase OS=Vigna angularis var. angularis GN=Vigan.09G016300 PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.8e-19 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Csa4G619050 vs. TrEMBL
Match: A0A0L9VUY7_PHAAN (Lysine--tRNA ligase OS=Phaseolus angularis GN=LR48_Vigan11g162800 PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 7.8e-19 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Csa4G619050 vs. TAIR10
Match: AT3G13490.1 (AT3G13490.1 Lysyl-tRNA synthetase, class II) HSP 1 Score: 93.6 bits (231), Expect = 6.3e-20 Identity = 44/52 (84.62%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Csa4G619050 vs. TAIR10
Match: AT3G11710.1 (AT3G11710.1 lysyl-tRNA synthetase 1) HSP 1 Score: 53.9 bits (128), Expect = 5.6e-08 Identity = 24/52 (46.15%), Postives = 33/52 (63.46%), Query Frame = 1
BLAST of Csa4G619050 vs. TAIR10
Match: AT3G30805.1 (AT3G30805.1 Class II aminoacyl-tRNA and biotin synthetases superfamily protein) HSP 1 Score: 51.2 bits (121), Expect = 3.6e-07 Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
BLAST of Csa4G619050 vs. NCBI nr
Match: gi|700199833|gb|KGN54991.1| (hypothetical protein Csa_4G619050 [Cucumis sativus]) HSP 1 Score: 174.5 bits (441), Expect = 8.0e-41 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. NCBI nr
Match: gi|449463846|ref|XP_004149642.1| (PREDICTED: probable lysine--tRNA ligase, cytoplasmic isoform X1 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-23 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. NCBI nr
Match: gi|778692760|ref|XP_011653520.1| (PREDICTED: probable lysine--tRNA ligase, cytoplasmic isoform X2 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-23 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. NCBI nr
Match: gi|778692763|ref|XP_011653521.1| (PREDICTED: probable lysine--tRNA ligase, cytoplasmic isoform X3 [Cucumis sativus]) HSP 1 Score: 114.8 bits (286), Expect = 7.5e-23 Identity = 57/58 (98.28%), Postives = 58/58 (100.00%), Query Frame = 1
BLAST of Csa4G619050 vs. NCBI nr
Match: gi|659097945|ref|XP_008449892.1| (PREDICTED: probable lysine--tRNA ligase, cytoplasmic isoform X2 [Cucumis melo]) HSP 1 Score: 107.8 bits (268), Expect = 9.2e-21 Identity = 53/58 (91.38%), Postives = 56/58 (96.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|