Csa4G190010 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTCAACCATTAAGCTATGCTGCCAAAAAGATAAGAGAAGCATCATGGAAGATGACTGATGAATACGTGAAGTCAGCGATAGACTTTCTAGCAACACAAGAGGACATATGTTGGACGAGAACATCATCGTCATCATCTTCCTCCATTGTTCGAGTTAAAGGCACATCCTTGAGCAACCCGAATCTATCTATAGTGTCTTGGTTGTCGATGCCCATATATGATGCAGACTTTGGGTGGGGATACCCAGATTATGTTGGACCATCAATGTTAGCTTATGATGGGAAGATGTTCATCATGCCAGGGCCAAACAATGATGGTTTGATCATCGTTGCAATACAGTTGCAGATGAAGCATATGGAGTATTTCAAAAAGTTCTTCTATGAAGATCTTTGA ATGTCTCAACCATTAAGCTATGCTGCCAAAAAGATAAGAGAAGCATCATGGAAGATGACTGATGAATACGTGAAGTCAGCGATAGACTTTCTAGCAACACAAGAGGACATATGTTGGACGAGAACATCATCGTCATCATCTTCCTCCATTGTTCGAGTTAAAGGCACATCCTTGAGCAACCCGAATCTATCTATAGTGTCTTGGTTGTCGATGCCCATATATGATGCAGACTTTGGGTGGGGATACCCAGATTATGTTGGACCATCAATGTTAGCTTATGATGGGAAGATGTTCATCATGCCAGGGCCAAACAATGATGGTTTGATCATCGTTGCAATACAGTTGCAGATGAAGCATATGGAGTATTTCAAAAAGTTCTTCTATGAAGATCTTTGA ATGTCTCAACCATTAAGCTATGCTGCCAAAAAGATAAGAGAAGCATCATGGAAGATGACTGATGAATACGTGAAGTCAGCGATAGACTTTCTAGCAACACAAGAGGACATATGTTGGACGAGAACATCATCGTCATCATCTTCCTCCATTGTTCGAGTTAAAGGCACATCCTTGAGCAACCCGAATCTATCTATAGTGTCTTGGTTGTCGATGCCCATATATGATGCAGACTTTGGGTGGGGATACCCAGATTATGTTGGACCATCAATGTTAGCTTATGATGGGAAGATGTTCATCATGCCAGGGCCAAACAATGATGGTTTGATCATCGTTGCAATACAGTTGCAGATGAAGCATATGGAGTATTTCAAAAAGTTCTTCTATGAAGATCTTTGA MSQPLSYAAKKIREASWKMTDEYVKSAIDFLATQEDICWTRTSSSSSSSIVRVKGTSLSNPNLSIVSWLSMPIYDADFGWGYPDYVGPSMLAYDGKMFIMPGPNNDGLIIVAIQLQMKHMEYFKKFFYEDL*
BLAST of Csa4G190010 vs. Swiss-Prot
Match: HST_ARATH (Shikimate O-hydroxycinnamoyltransferase OS=Arabidopsis thaliana GN=HST PE=2 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.3e-25 Identity = 57/129 (44.19%), Postives = 80/129 (62.02%), Query Frame = 1
BLAST of Csa4G190010 vs. Swiss-Prot
Match: HST_TOBAC (Shikimate O-hydroxycinnamoyltransferase OS=Nicotiana tabacum GN=HST PE=1 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 7.3e-25 Identity = 57/128 (44.53%), Postives = 80/128 (62.50%), Query Frame = 1
BLAST of Csa4G190010 vs. Swiss-Prot
Match: RAS_MELOI (Rosmarinate synthase OS=Melissa officinalis GN=RAS PE=1 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 4.0e-23 Identity = 51/128 (39.84%), Postives = 78/128 (60.94%), Query Frame = 1
BLAST of Csa4G190010 vs. Swiss-Prot
Match: SHT_ARATH (Spermidine hydroxycinnamoyl transferase OS=Arabidopsis thaliana GN=SHT PE=1 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 6.9e-23 Identity = 55/131 (41.98%), Postives = 76/131 (58.02%), Query Frame = 1
BLAST of Csa4G190010 vs. Swiss-Prot
Match: RAS_PLESU (Rosmarinate synthase OS=Plectranthus scutellarioides GN=RAS PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 9.9e-22 Identity = 49/128 (38.28%), Postives = 75/128 (58.59%), Query Frame = 1
BLAST of Csa4G190010 vs. TrEMBL
Match: A0A0A0KWD6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G190020 PE=4 SV=1) HSP 1 Score: 271.2 bits (692), Expect = 6.8e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of Csa4G190010 vs. TrEMBL
Match: A0A0A0KYM3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G190010 PE=4 SV=1) HSP 1 Score: 271.2 bits (692), Expect = 6.8e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of Csa4G190010 vs. TrEMBL
Match: A0A0A0KZY3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G189010 PE=4 SV=1) HSP 1 Score: 233.0 bits (593), Expect = 2.1e-58 Identity = 112/131 (85.50%), Postives = 118/131 (90.08%), Query Frame = 1
BLAST of Csa4G190010 vs. TrEMBL
Match: A0A0A0L1B3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G189000 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 2.1e-55 Identity = 109/125 (87.20%), Postives = 117/125 (93.60%), Query Frame = 1
BLAST of Csa4G190010 vs. TrEMBL
Match: U5GDT6_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0006s17880g PE=4 SV=1) HSP 1 Score: 132.9 bits (333), Expect = 2.9e-28 Identity = 64/131 (48.85%), Postives = 87/131 (66.41%), Query Frame = 1
BLAST of Csa4G190010 vs. TAIR10
Match: AT5G48930.1 (AT5G48930.1 hydroxycinnamoyl-CoA shikimate/quinate hydroxycinnamoyl transferase) HSP 1 Score: 114.8 bits (286), Expect = 4.1e-26 Identity = 57/129 (44.19%), Postives = 80/129 (62.02%), Query Frame = 1
BLAST of Csa4G190010 vs. TAIR10
Match: AT2G19070.1 (AT2G19070.1 spermidine hydroxycinnamoyl transferase) HSP 1 Score: 108.2 bits (269), Expect = 3.9e-24 Identity = 55/131 (41.98%), Postives = 76/131 (58.02%), Query Frame = 1
BLAST of Csa4G190010 vs. TAIR10
Match: AT5G41040.1 (AT5G41040.1 HXXXD-type acyl-transferase family protein) HSP 1 Score: 49.7 bits (117), Expect = 1.6e-06 Identity = 36/129 (27.91%), Postives = 54/129 (41.86%), Query Frame = 1
BLAST of Csa4G190010 vs. NCBI nr
Match: gi|449462794|ref|XP_004149125.1| (PREDICTED: spermidine hydroxycinnamoyl transferase [Cucumis sativus]) HSP 1 Score: 271.2 bits (692), Expect = 9.8e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of Csa4G190010 vs. NCBI nr
Match: gi|700198771|gb|KGN53929.1| (hypothetical protein Csa_4G190010 [Cucumis sativus]) HSP 1 Score: 271.2 bits (692), Expect = 9.8e-70 Identity = 131/131 (100.00%), Postives = 131/131 (100.00%), Query Frame = 1
BLAST of Csa4G190010 vs. NCBI nr
Match: gi|449462792|ref|XP_004149124.1| (PREDICTED: spermidine hydroxycinnamoyl transferase-like [Cucumis sativus]) HSP 1 Score: 233.0 bits (593), Expect = 2.9e-58 Identity = 112/131 (85.50%), Postives = 118/131 (90.08%), Query Frame = 1
BLAST of Csa4G190010 vs. NCBI nr
Match: gi|778697602|ref|XP_004149123.2| (PREDICTED: shikimate O-hydroxycinnamoyltransferase-like [Cucumis sativus]) HSP 1 Score: 223.0 bits (567), Expect = 3.0e-55 Identity = 109/125 (87.20%), Postives = 117/125 (93.60%), Query Frame = 1
BLAST of Csa4G190010 vs. NCBI nr
Match: gi|700198768|gb|KGN53926.1| (hypothetical protein Csa_4G189000 [Cucumis sativus]) HSP 1 Score: 223.0 bits (567), Expect = 3.0e-55 Identity = 109/125 (87.20%), Postives = 117/125 (93.60%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|