Csa4G189510 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CATAACACAATCGCAATGTAGGCTAATTTACTTGGTTAATCAGAATGCCAAATAACAAAAACACGACATTTCAACCGTTCAATTGAAGTTGAAAATCCAGGCTTACTTTGAATTTGGCAAGGAGAGGGTTGCTCTGTATTGAAATGGAATTTCCATGAGTGCGGCCAAGGCAAATGTTGCTTCCTTCTTTGACGCTTCTGTGCTCTCAGACATGATCTTTGTGAAGTTTACAAACTGAATCAATAGAGAGAAGCCGTGAAGTTACACACTGAACCAAAAACAATTGAACACCCATGTTTTCTTTTTGAAAACCAGGAGATGGAGTTTTGCTCTCAGTGGTTTATGGATAACGTACAAACAGAAATTAGAAGGCATATTCCAAAAGAAAAAAAGAAAGAAAGTAGAATGAATGCTGACTATTATGATCGTGGTTCTCCAACTATGTGGCACCATGATCAATACCCATACCTGTTAATATCCATTTTTTTAAAACCCCTATAGCAGCAACTTTCTATAGAATATGTATTATTGTACTAAAAAAATGATTGCCACACAAATATTACACATAATCTTATAAGGAGCTAATGCAATTATTTCAACCGGAGACACCAAAGAATAAGGTATAGCCATCATTAGTGAGTTTGACAGCAGAAGAGGTAGAGAAGAAGATAAAAGAAGAAATGACAGAGGTTTATGTTTCAGTGGTTCCTCCTGATTATGCCATAACTTCTGATCTTAGATTTAATCGTGTTTGGCTATTCGTTGATTCTTCTGGCAAAGTTATACAAACACCTTCTATTGGTTAA ATGAGTGCGGCCAAGGCAAATGTTGCTTCCTTCTTTGACGCTTCTGTGCTCTCAGACATGATCTTTGAGATGGAGTTTTGCTCTCAGTGGTTTATGGATAACGTACAAACAGAAATTAGAAGGCATATTCCAAAAGAAAAAAAGAAAGAAAGTAGAATGAATGCTGACTATTATGATCGTGCAGAAGAGGTAGAGAAGAAGATAAAAGAAGAAATGACAGAGGTTTATGTTTCAGTGGTTCCTCCTGATTATGCCATAACTTCTGATCTTAGATTTAATCGTGTTTGGCTATTCGTTGATTCTTCTGGCAAAGTTATACAAACACCTTCTATTGGTTAA ATGAGTGCGGCCAAGGCAAATGTTGCTTCCTTCTTTGACGCTTCTGTGCTCTCAGACATGATCTTTGAGATGGAGTTTTGCTCTCAGTGGTTTATGGATAACGTACAAACAGAAATTAGAAGGCATATTCCAAAAGAAAAAAAGAAAGAAAGTAGAATGAATGCTGACTATTATGATCGTGCAGAAGAGGTAGAGAAGAAGATAAAAGAAGAAATGACAGAGGTTTATGTTTCAGTGGTTCCTCCTGATTATGCCATAACTTCTGATCTTAGATTTAATCGTGTTTGGCTATTCGTTGATTCTTCTGGCAAAGTTATACAAACACCTTCTATTGGTTAA MSAAKANVASFFDASVLSDMIFEMEFCSQWFMDNVQTEIRRHIPKEKKKESRMNADYYDRAEEVEKKIKEEMTEVYVSVVPPDYAITSDLRFNRVWLFVDSSGKVIQTPSIG*
BLAST of Csa4G189510 vs. Swiss-Prot
Match: ICI1_PHAAN (Subtilisin inhibitor 1 OS=Phaseolus angularis PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.5e-07 Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 1
BLAST of Csa4G189510 vs. Swiss-Prot
Match: ICI1_CANLI (Subtilisin inhibitor CLSI-I OS=Canavalia lineata PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.7e-06 Identity = 29/52 (55.77%), Postives = 34/52 (65.38%), Query Frame = 1
BLAST of Csa4G189510 vs. Swiss-Prot
Match: ICIS_VICFA (Subtilisin inhibitor (Fragment) OS=Vicia faba PE=1 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.8e-06 Identity = 25/50 (50.00%), Postives = 31/50 (62.00%), Query Frame = 1
BLAST of Csa4G189510 vs. TrEMBL
Match: A0A0A0KWM2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G189510 PE=4 SV=1) HSP 1 Score: 226.5 bits (576), Expect = 1.6e-56 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Csa4G189510 vs. TrEMBL
Match: A0A0A0KX92_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G296240 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 4.8e-16 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Csa4G189510 vs. TrEMBL
Match: V7BVE7_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_005G032000g PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 2.8e-08 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Csa4G189510 vs. TrEMBL
Match: G7IW97_MEDTR (Subtilisin inhibitor 1 OS=Medicago truncatula GN=MTR_3g020970 PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 4.9e-08 Identity = 31/52 (59.62%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Csa4G189510 vs. TrEMBL
Match: A0A067EAY7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g034123mg PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.4e-07 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 1
BLAST of Csa4G189510 vs. NCBI nr
Match: gi|700198770|gb|KGN53928.1| (hypothetical protein Csa_4G189510 [Cucumis sativus]) HSP 1 Score: 226.5 bits (576), Expect = 2.4e-56 Identity = 112/112 (100.00%), Postives = 112/112 (100.00%), Query Frame = 1
BLAST of Csa4G189510 vs. NCBI nr
Match: gi|778697662|ref|XP_011654371.1| (PREDICTED: subtilisin inhibitor CLSI-I-like [Cucumis sativus]) HSP 1 Score: 92.0 bits (227), Expect = 6.9e-16 Identity = 45/52 (86.54%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Csa4G189510 vs. NCBI nr
Match: gi|593697034|ref|XP_007148999.1| (hypothetical protein PHAVU_005G032000g [Phaseolus vulgaris]) HSP 1 Score: 66.2 bits (160), Expect = 4.1e-08 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Csa4G189510 vs. NCBI nr
Match: gi|357457017|ref|XP_003598789.1| (subtilisin inhibitor 1 [Medicago truncatula]) HSP 1 Score: 65.5 bits (158), Expect = 7.0e-08 Identity = 31/52 (59.62%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Csa4G189510 vs. NCBI nr
Match: gi|1012207901|ref|XP_015932366.1| (PREDICTED: subtilisin inhibitor CLSI-I-like [Arachis duranensis]) HSP 1 Score: 65.1 bits (157), Expect = 9.1e-08 Identity = 30/52 (57.69%), Postives = 39/52 (75.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|