Csa4G171500 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CTCATCAAACTCATCATCTTCACAGTACATTACTCTAATGGACGAGAACAAGAGGTTGAAGAAGGAAAATGGGGCCTTAAGCTCAGAACTTGCAAGCATGAAAAACAAATGCAAAGGGCTTTTTGATTTGGTGGCTACGTATGAAAATATTTCAAAGAAAGAAGATGAAGATGTGAGGCCAAAGCTGTTTGGAGTAAGGTTGGAAGGAGAGAGAGAGAGGAAGATAAAAAGGGGAGAAGAGATTAGTGAAACTACAACTATTTTGCTATCTCAATCATGCAAATGA ATGGACGAGAACAAGAGGTTGAAGAAGGAAAATGGGGCCTTAAGCTCAGAACTTGCAAGCATGAAAAACAAATGCAAAGGGCTTTTTGATTTGGTGGCTACGTATGAAAATATTTCAAAGAAAGAAGATGAAGATGTGAGGCCAAAGCTGTTTGGAGTAAGGTTGGAAGGAGAGAGAGAGAGGAAGATAAAAAGGGGAGAAGAGATTAGTGAAACTACAACTATTTTGCTATCTCAATCATGCAAATGA ATGGACGAGAACAAGAGGTTGAAGAAGGAAAATGGGGCCTTAAGCTCAGAACTTGCAAGCATGAAAAACAAATGCAAAGGGCTTTTTGATTTGGTGGCTACGTATGAAAATATTTCAAAGAAAGAAGATGAAGATGTGAGGCCAAAGCTGTTTGGAGTAAGGTTGGAAGGAGAGAGAGAGAGGAAGATAAAAAGGGGAGAAGAGATTAGTGAAACTACAACTATTTTGCTATCTCAATCATGCAAATGA MDENKRLKKENGALSSELASMKNKCKGLFDLVATYENISKKEDEDVRPKLFGVRLEGERERKIKRGEEISETTTILLSQSCK*
BLAST of Csa4G171500 vs. TrEMBL
Match: A0A0A0KW58_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G171500 PE=4 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 1.6e-37 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G171500 vs. TrEMBL
Match: A0A0U3SRJ2_VITPS (Transcription factor HsfB3a OS=Vitis pseudoreticulata PE=2 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 7.4e-22 Identity = 60/84 (71.43%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of Csa4G171500 vs. TrEMBL
Match: F6HKV6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g08750 PE=3 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.3e-21 Identity = 60/84 (71.43%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of Csa4G171500 vs. TrEMBL
Match: A0A0B2Q4L1_GLYSO (Heat stress transcription factor B-3 OS=Glycine soja GN=glysoja_024088 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.3e-20 Identity = 54/83 (65.06%), Postives = 67/83 (80.72%), Query Frame = 1
BLAST of Csa4G171500 vs. TrEMBL
Match: I1N8Z6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_19G137800 PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.3e-20 Identity = 54/83 (65.06%), Postives = 67/83 (80.72%), Query Frame = 1
BLAST of Csa4G171500 vs. TAIR10
Match: AT2G41690.1 (AT2G41690.1 heat shock transcription factor B3) HSP 1 Score: 50.1 bits (118), Expect = 7.8e-07 Identity = 29/62 (46.77%), Postives = 33/62 (53.23%), Query Frame = 1
BLAST of Csa4G171500 vs. NCBI nr
Match: gi|449463360|ref|XP_004149402.1| (PREDICTED: heat stress transcription factor B-3 [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 2.4e-37 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G171500 vs. NCBI nr
Match: gi|700198702|gb|KGN53860.1| (hypothetical protein Csa_4G171500 [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 2.4e-37 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G171500 vs. NCBI nr
Match: gi|659121625|ref|XP_008460754.1| (PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor B-3 [Cucumis melo]) HSP 1 Score: 150.6 bits (379), Expect = 1.2e-33 Identity = 77/82 (93.90%), Postives = 78/82 (95.12%), Query Frame = 1
BLAST of Csa4G171500 vs. NCBI nr
Match: gi|971533959|gb|ALV82484.1| (transcription factor HsfB3a [Vitis pseudoreticulata]) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-21 Identity = 60/84 (71.43%), Postives = 67/84 (79.76%), Query Frame = 1
BLAST of Csa4G171500 vs. NCBI nr
Match: gi|225441862|ref|XP_002284216.1| (PREDICTED: heat stress transcription factor B-3 [Vitis vinifera]) HSP 1 Score: 110.2 bits (274), Expect = 1.8e-21 Identity = 60/84 (71.43%), Postives = 67/84 (79.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|