Csa4G168990 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAATGTCCGTGCGTCTTAGATTGTTCTGATGAAACATCGGTTATTCACCAAAATCTATAACATTATACATCTTTCATATGTATATCCTGTCCCCTCTTCTTTCTCACGATTTTCATTTGGAGTGACTCTTGTTGGTGTCAGTTTATTTTGTCCATCATTACTTGTTTTTTGTACCTCACTTTTGTTGCACTTTCTTCCTTCCTCTCGATGTTTGTGGGTTTATAAACCAAAAAAGAAACCTGTGTATACTTGTTTTCTAATTCATTTGTTCAGGATCTTGTAACTGAAGTTCAATGCACTCTGTACACAACTCTGTCGGAATTCGATGGTAATGTTGAAGACGAGAATGGTTTAGAAAGTCTTATAGAAGTGCAGTTTGAAGCATTGCAGAAAGCGATGAAGGTGTCACACAAGGCAGCAGAAGCTCGTTTGAGAGTATCGAAGAAACTACTTACTCTATTCAGGGCAGGTAAGCTTGGTCAATTCATCCTTGATGATGTCCCTATCACAAAAGTTTCTTAGGAAATTTATATTCTCCGTGTTTTGTTGAAAGGACTTTGCTTTAATGGTGATTTAATTAGTAGAGCTATTAGTTTGTATTT ATGAAATGTCCGTGCGTCTTAGATTGTTCTGATGAAACATCGGATCTTGTAACTGAAGTTCAATGCACTCTGTACACAACTCTGTCGGAATTCGATGGTAATGTTGAAGACGAGAATGGTTTAGAAAGTCTTATAGAAGTGCAGTTTGAAGCATTGCAGAAAGCGATGAAGGTGTCACACAAGGCAGCAGAAGCTCGTTTGAGAGTATCGAAGAAACTACTTACTCTATTCAGGGCAGGTAAGCTTGGTCAATTCATCCTTGATGATGTCCCTATCACAAAAGTTTCTTAG ATGAAATGTCCGTGCGTCTTAGATTGTTCTGATGAAACATCGGATCTTGTAACTGAAGTTCAATGCACTCTGTACACAACTCTGTCGGAATTCGATGGTAATGTTGAAGACGAGAATGGTTTAGAAAGTCTTATAGAAGTGCAGTTTGAAGCATTGCAGAAAGCGATGAAGGTGTCACACAAGGCAGCAGAAGCTCGTTTGAGAGTATCGAAGAAACTACTTACTCTATTCAGGGCAGGTAAGCTTGGTCAATTCATCCTTGATGATGTCCCTATCACAAAAGTTTCTTAG MKCPCVLDCSDETSDLVTEVQCTLYTTLSEFDGNVEDENGLESLIEVQFEALQKAMKVSHKAAEARLRVSKKLLTLFRAGKLGQFILDDVPITKVS*
BLAST of Csa4G168990 vs. Swiss-Prot
Match: SIN2_ARATH (Short integuments 2, mitochondrial OS=Arabidopsis thaliana GN=SIN2 PE=1 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.2e-25 Identity = 57/80 (71.25%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Csa4G168990 vs. Swiss-Prot
Match: DGP2_ARATH (DAR GTPase 2, mitochondrial OS=Arabidopsis thaliana GN=DGP2 PE=3 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.4e-12 Identity = 39/83 (46.99%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Csa4G168990 vs. TrEMBL
Match: A0A0A0KZR0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G168990 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 6.6e-46 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 1
BLAST of Csa4G168990 vs. TrEMBL
Match: F6HKV4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_08s0007g08770 PE=4 SV=1) HSP 1 Score: 122.1 bits (305), Expect = 3.8e-25 Identity = 61/77 (79.22%), Postives = 67/77 (87.01%), Query Frame = 1
BLAST of Csa4G168990 vs. TrEMBL
Match: B9H9S8_POPTR (GTP-binding family protein OS=Populus trichocarpa GN=POPTR_0006s04750g PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 8.4e-25 Identity = 60/79 (75.95%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of Csa4G168990 vs. TrEMBL
Match: B9T5C1_RICCO (GTP binding protein, putative OS=Ricinus communis GN=RCOM_0770010 PE=4 SV=1) HSP 1 Score: 120.2 bits (300), Expect = 1.4e-24 Identity = 59/79 (74.68%), Postives = 68/79 (86.08%), Query Frame = 1
BLAST of Csa4G168990 vs. TrEMBL
Match: M5VVZ7_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa007169mg PE=4 SV=1) HSP 1 Score: 118.2 bits (295), Expect = 5.4e-24 Identity = 59/77 (76.62%), Postives = 66/77 (85.71%), Query Frame = 1
BLAST of Csa4G168990 vs. TAIR10
Match: AT2G41670.1 (AT2G41670.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 115.5 bits (288), Expect = 1.8e-26 Identity = 57/80 (71.25%), Postives = 65/80 (81.25%), Query Frame = 1
BLAST of Csa4G168990 vs. TAIR10
Match: AT4G10650.1 (AT4G10650.1 P-loop containing nucleoside triphosphate hydrolases superfamily protein) HSP 1 Score: 73.6 bits (179), Expect = 7.7e-14 Identity = 39/83 (46.99%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Csa4G168990 vs. NCBI nr
Match: gi|700198699|gb|KGN53857.1| (hypothetical protein Csa_4G168990 [Cucumis sativus]) HSP 1 Score: 191.0 bits (484), Expect = 9.4e-46 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 1
BLAST of Csa4G168990 vs. NCBI nr
Match: gi|778692270|ref|XP_011653431.1| (PREDICTED: mitochondrial GTPase 1 isoform X2 [Cucumis sativus]) HSP 1 Score: 159.5 bits (402), Expect = 3.0e-36 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G168990 vs. NCBI nr
Match: gi|778692268|ref|XP_004149387.2| (PREDICTED: mitochondrial ribosome-associated GTPase 1 isoform X1 [Cucumis sativus]) HSP 1 Score: 159.5 bits (402), Expect = 3.0e-36 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G168990 vs. NCBI nr
Match: gi|659121629|ref|XP_008460756.1| (PREDICTED: mitochondrial GTPase 1 isoform X1 [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 7.5e-35 Identity = 79/82 (96.34%), Postives = 80/82 (97.56%), Query Frame = 1
BLAST of Csa4G168990 vs. NCBI nr
Match: gi|659121631|ref|XP_008460757.1| (PREDICTED: mitochondrial GTPase 1 isoform X2 [Cucumis melo]) HSP 1 Score: 154.8 bits (390), Expect = 7.5e-35 Identity = 79/82 (96.34%), Postives = 80/82 (97.56%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|