Csa4G165880 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTACTTGGTATGTGCTTTAAATTCATGCATTGTCAATATATATATTTTTATTCTAGCAGTATCTTGGAGTTTGAAGTGAGGTTCCTTCACCAATATATCGTTATACTTTGTTTCTAAATTTTTTTCTTGCATCATCCTCACTTGTATTGGACATTTTCTCTCTATAGCTTGATTTTTAGACAGAATGCCAGTTTATTATTGCAGTTAATTGTTTTAGATGAGATAGCAACTTGACATGTGTTCCACAGGATATTTACTGTTTGGACGCTGATGGTTCTCTTTTTGATGCTGCACTTCTTTCTGCAGCAGCTGCATTTTCTCACTGTGAGGTTTCAGGCTCTCAACTTGTTCCCAACATGATATATTTCTGTGTAATTTGGTACATGTTATGCTTATGGCAGTAATGTCAATTATGGTGGGATAGGACATTTTGTCCTCCGTTAACACTAAGAATAGTTTTTCAGATTATAGATTGTTACTTTATGCTTTTAATCTTTTACATTTCTGATTTTTTTCCCTCTTTAGATTCCTTTTGTTATCAAAATTTATAGGGACACTTATGGCCCGTAACAACCAACTTTGGCAACCATACCCC ATGGCTTACTTGGATATTTACTGTTTGGACGCTGATGGTTCTCTTTTTGATGCTGCACTTCTTTCTGCAGCAGCTGCATTTTCTCACTGTGAGGTTTCAGGCTCTCAACTTGTTCCCAACATGATATATTTCTGTGTAATTTGGTACATGTTATGCTTATGGCAGTAA ATGGCTTACTTGGATATTTACTGTTTGGACGCTGATGGTTCTCTTTTTGATGCTGCACTTCTTTCTGCAGCAGCTGCATTTTCTCACTGTGAGGTTTCAGGCTCTCAACTTGTTCCCAACATGATATATTTCTGTGTAATTTGGTACATGTTATGCTTATGGCAGTAA MAYLDIYCLDADGSLFDAALLSAAAAFSHCEVSGSQLVPNMIYFCVIWYMLCLWQ*
BLAST of Csa4G165880 vs. TrEMBL
Match: A0A0A0KWB3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G165880 PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.1e-24 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
BLAST of Csa4G165880 vs. TrEMBL
Match: A0A103Y6N3_CYNCS (Exoribonuclease, phosphorolytic domain 2 OS=Cynara cardunculus var. scolymus GN=Ccrd_018206 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.0e-07 Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
BLAST of Csa4G165880 vs. TrEMBL
Match: A0A068UIP4_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00027264001 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 5.9e-07 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Csa4G165880 vs. TrEMBL
Match: A0A068VEJ1_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00012655001 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 5.9e-07 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Csa4G165880 vs. TrEMBL
Match: A0A0B0MVX7_GOSAR (Exosome complex component RRP43 OS=Gossypium arboreum GN=F383_26456 PE=4 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 7.7e-07 Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 1
BLAST of Csa4G165880 vs. TAIR10
Match: AT1G60080.1 (AT1G60080.1 3'-5'-exoribonuclease family protein) HSP 1 Score: 54.3 bits (129), Expect = 2.8e-08 Identity = 24/32 (75.00%), Postives = 27/32 (84.38%), Query Frame = 1
BLAST of Csa4G165880 vs. NCBI nr
Match: gi|700198685|gb|KGN53843.1| (hypothetical protein Csa_4G165880 [Cucumis sativus]) HSP 1 Score: 119.8 bits (299), Expect = 1.5e-24 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 1
BLAST of Csa4G165880 vs. NCBI nr
Match: gi|659121683|ref|XP_008460773.1| (PREDICTED: exosome complex component RRP43 isoform X2 [Cucumis melo]) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 1
BLAST of Csa4G165880 vs. NCBI nr
Match: gi|449463354|ref|XP_004149399.1| (PREDICTED: exosome complex component RRP43 [Cucumis sativus]) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 1
BLAST of Csa4G165880 vs. NCBI nr
Match: gi|976918298|gb|KVI03487.1| (Exoribonuclease, phosphorolytic domain 2 [Cynara cardunculus var. scolymus]) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-07 Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
BLAST of Csa4G165880 vs. NCBI nr
Match: gi|659121681|ref|XP_008460772.1| (PREDICTED: exosome complex component RRP43 isoform X1 [Cucumis melo]) HSP 1 Score: 62.4 bits (150), Expect = 2.9e-07 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|