Csa4G154310 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAAAAGCTATTGCATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAA ATGAAAAAAGCTATTGCATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAA ATGAAAAAAGCTATTGCATTAACTGAACAGGCGGGTACAAAGGGAATTCAAGTACAAATTGCCGGACGTATAGACGGAAAAGAAATTGCACGTGTCGAATGGATCAGAGAAGGACGGGTTCCTCTACAAACCATTCGAGCTAAAATTGATTATTGTTGCTATCCAGTTCGAACTATCTATGGGATATTAGGCATAAAAATTTGGATATTTGTAGACGAGCAATAA MKKAIALTEQAGTKGIQVQIAGRIDGKEIARVEWIREGRVPLQTIRAKIDYCCYPVRTIYGILGIKIWIFVDEQ*
BLAST of Csa4G154310 vs. Swiss-Prot
Match: RR3_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus GN=rps3 PE=3 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 6.8e-36 Identity = 73/74 (98.65%), Postives = 71/74 (95.95%), Query Frame = 1
BLAST of Csa4G154310 vs. Swiss-Prot
Match: RR3_LACSA (30S ribosomal protein S3, chloroplastic OS=Lactuca sativa GN=rps3 PE=3 SV=1) HSP 1 Score: 140.2 bits (352), Expect = 9.2e-33 Identity = 67/72 (93.06%), Postives = 67/72 (93.06%), Query Frame = 1
BLAST of Csa4G154310 vs. Swiss-Prot
Match: RR3_DRIGR (30S ribosomal protein S3, chloroplastic OS=Drimys granadensis GN=rps3 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 2.7e-32 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 1
BLAST of Csa4G154310 vs. Swiss-Prot
Match: RR3_SOYBN (30S ribosomal protein S3, chloroplastic OS=Glycine max GN=rps3 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 2.7e-32 Identity = 65/70 (92.86%), Postives = 66/70 (94.29%), Query Frame = 1
BLAST of Csa4G154310 vs. Swiss-Prot
Match: RR3_LIRTU (30S ribosomal protein S3, chloroplastic OS=Liriodendron tulipifera GN=rps3 PE=3 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 2.7e-32 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 1
BLAST of Csa4G154310 vs. TrEMBL
Match: A0A0A0L114_CUCSA (30S ribosomal protein S3, chloroplastic OS=Cucumis sativus GN=Csa_4G154310 PE=3 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 2.0e-34 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa4G154310 vs. TrEMBL
Match: W8E3G6_9ROSI (Ribosomal protein S3 OS=Cucumis hystrix GN=rps3 PE=3 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 7.6e-34 Identity = 73/74 (98.65%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. TrEMBL
Match: X2EYI2_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-34 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. TrEMBL
Match: X2F0P5_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-34 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. TrEMBL
Match: X2EZ87_LAGSI (30S ribosomal protein S3, chloroplastic OS=Lagenaria siceraria GN=rps3 PE=3 SV=1) HSP 1 Score: 150.2 bits (378), Expect = 9.9e-34 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. TAIR10
Match: ATCG00800.1 (ATCG00800.1 structural constituent of ribosome) HSP 1 Score: 137.9 bits (346), Expect = 2.6e-33 Identity = 67/74 (90.54%), Postives = 67/74 (90.54%), Query Frame = 1
BLAST of Csa4G154310 vs. NCBI nr
Match: gi|700198673|gb|KGN53831.1| (30S ribosomal protein S3, chloroplastic [Cucumis sativus]) HSP 1 Score: 152.5 bits (384), Expect = 2.9e-34 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Csa4G154310 vs. NCBI nr
Match: gi|68164842|ref|YP_247638.1| (ribosomal protein S3 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 1.1e-33 Identity = 73/74 (98.65%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. NCBI nr
Match: gi|952954725|gb|ALO22084.1| (ribosomal protein S3 (plastid) [Cucurbita ecuadorensis]) HSP 1 Score: 150.2 bits (378), Expect = 1.4e-33 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. NCBI nr
Match: gi|595645361|gb|AHM88822.1| (ribosomal protein S3, partial (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 150.2 bits (378), Expect = 1.4e-33 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
BLAST of Csa4G154310 vs. NCBI nr
Match: gi|346578230|ref|YP_004841822.1| (ribosomal protein S3 [Cucumis melo subsp. melo]) HSP 1 Score: 150.2 bits (378), Expect = 1.4e-33 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|