Csa4G056690 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGGAATAAAGGTTTGATAGTAGAAATATTCATTTCCTCTTTTTTCATTTTTCTATTCCAATAGAGCGAGAGAGAGAGAGAGATCACCGGTTTCATCATCGCCAGCTTCCAACAACAACAACAACAAGAAGAAGAGGAAGAAGAACGATTTGATTTCGATTTCAATGGGGGAAGAAATGGAGCAACTTGTAAACATGGGTTTTCCCGACGAACTGGCCGCTCAAGCCTTAGCAGCCACCGGCGGAAAGTCCACTCTCAAAGCCACTGAATGGATTCTCAATCATAAATCCTCTTCTCCTTCCCCCAAGCCTAATCTCCCCATTTCTTCTAATCCTAATCTCCAGCCCAAACTCGACCGCTTCTTCCATTTCCAGCCCCGCCCACCTCCCCCCTCCGCCTCCCACGTCCAATAA ATGAGGAATAAAGCTTCCAACAACAACAACAACAAGAAGAAGAGGAAGAAGAACGATTTGATTTCGATTTCAATGGGGGAAGAAATGGAGCAACTTGTAAACATGGGTTTTCCCGACGAACTGGCCGCTCAAGCCTTAGCAGCCACCGGCGGAAAGTCCACTCTCAAAGCCACTGAATGGATTCTCAATCATAAATCCTCTTCTCCTTCCCCCAAGCCTAATCTCCCCATTTCTTCTAATCCTAATCTCCAGCCCAAACTCGACCGCTTCTTCCATTTCCAGCCCCGCCCACCTCCCCCCTCCGCCTCCCACGTCCAATAA ATGAGGAATAAAGCTTCCAACAACAACAACAACAAGAAGAAGAGGAAGAAGAACGATTTGATTTCGATTTCAATGGGGGAAGAAATGGAGCAACTTGTAAACATGGGTTTTCCCGACGAACTGGCCGCTCAAGCCTTAGCAGCCACCGGCGGAAAGTCCACTCTCAAAGCCACTGAATGGATTCTCAATCATAAATCCTCTTCTCCTTCCCCCAAGCCTAATCTCCCCATTTCTTCTAATCCTAATCTCCAGCCCAAACTCGACCGCTTCTTCCATTTCCAGCCCCGCCCACCTCCCCCCTCCGCCTCCCACGTCCAATAA MRNKASNNNNNKKKRKKNDLISISMGEEMEQLVNMGFPDELAAQALAATGGKSTLKATEWILNHKSSSPSPKPNLPISSNPNLQPKLDRFFHFQPRPPPPSASHVQ*
BLAST of Csa4G056690 vs. TrEMBL
Match: A0A0A0KV66_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G056690 PE=4 SV=1) HSP 1 Score: 219.2 bits (557), Expect = 2.5e-54 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Csa4G056690 vs. TrEMBL
Match: A0A061DKG2_THECC (AAA-type ATPase family protein OS=Theobroma cacao GN=TCM_002075 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 3.1e-20 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 1
BLAST of Csa4G056690 vs. TrEMBL
Match: A0A067E4V2_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g008664mg PE=4 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 5.2e-20 Identity = 56/88 (63.64%), Postives = 67/88 (76.14%), Query Frame = 1
BLAST of Csa4G056690 vs. TrEMBL
Match: V4SQQ8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10011398mg PE=4 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 1.2e-19 Identity = 55/88 (62.50%), Postives = 67/88 (76.14%), Query Frame = 1
BLAST of Csa4G056690 vs. TrEMBL
Match: A0A0D2R010_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_004G062600 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 4.4e-19 Identity = 54/82 (65.85%), Postives = 61/82 (74.39%), Query Frame = 1
BLAST of Csa4G056690 vs. TAIR10
Match: AT1G24290.1 (AT1G24290.1 AAA-type ATPase family protein) HSP 1 Score: 72.0 bits (175), Expect = 2.5e-13 Identity = 38/73 (52.05%), Postives = 44/73 (60.27%), Query Frame = 1
BLAST of Csa4G056690 vs. NCBI nr
Match: gi|700198322|gb|KGN53480.1| (hypothetical protein Csa_4G056690 [Cucumis sativus]) HSP 1 Score: 219.2 bits (557), Expect = 3.6e-54 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Csa4G056690 vs. NCBI nr
Match: gi|778691246|ref|XP_011653247.1| (PREDICTED: LOW QUALITY PROTEIN: ATPase WRNIP1 [Cucumis sativus]) HSP 1 Score: 172.6 bits (436), Expect = 3.8e-40 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa4G056690 vs. NCBI nr
Match: gi|659101966|ref|XP_008451883.1| (PREDICTED: ATPase WRNIP1 [Cucumis melo]) HSP 1 Score: 159.5 bits (402), Expect = 3.4e-36 Identity = 76/78 (97.44%), Postives = 76/78 (97.44%), Query Frame = 1
BLAST of Csa4G056690 vs. NCBI nr
Match: gi|590711336|ref|XP_007049077.1| (AAA-type ATPase family protein [Theobroma cacao]) HSP 1 Score: 105.9 bits (263), Expect = 4.4e-20 Identity = 54/77 (70.13%), Postives = 62/77 (80.52%), Query Frame = 1
BLAST of Csa4G056690 vs. NCBI nr
Match: gi|641831135|gb|KDO50204.1| (hypothetical protein CISIN_1g008664mg [Citrus sinensis]) HSP 1 Score: 105.1 bits (261), Expect = 7.5e-20 Identity = 56/88 (63.64%), Postives = 67/88 (76.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|