Csa3G875940 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTGTTGTTGGTGAATGCAAGGTTATTGAGCACAAACCGTACGATCATAAAGCTGATGTTTATAGCTTTGGGATAGTGTTGTGGGAGCTGCTTACAGGACAGGTAAATCCGTTTCTTTTGTTATAAATGCAAGCATTCGTTTTTATTTTCTTCCTAACCATGTTGGGGTTGCAATCTTGACATTGTGTCTGGAATGGCAGCTGCCTTATAATAACTTGACTCCGTTACAAGCAGCAATAGGAGTAGTCCAGAAGGTATTTCCATATTCACACCATATTAAATAA ATGTTTGTTGTTGGTGAATGCAAGGTTATTGAGCACAAACCGTACGATCATAAAGCTGATGTTTATAGCTTTGGGATAGTGTTGTGGGAGCTGCTTACAGGACAGCTGCCTTATAATAACTTGACTCCGTTACAAGCAGCAATAGGAGTAGTCCAGAAGGTATTTCCATATTCACACCATATTAAATAA ATGTTTGTTGTTGGTGAATGCAAGGTTATTGAGCACAAACCGTACGATCATAAAGCTGATGTTTATAGCTTTGGGATAGTGTTGTGGGAGCTGCTTACAGGACAGCTGCCTTATAATAACTTGACTCCGTTACAAGCAGCAATAGGAGTAGTCCAGAAGGTATTTCCATATTCACACCATATTAAATAA MFVVGECKVIEHKPYDHKADVYSFGIVLWELLTGQLPYNNLTPLQAAIGVVQKVFPYSHHIK*
BLAST of Csa3G875940 vs. Swiss-Prot
Match: STY46_ARATH (Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.3e-16 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of Csa3G875940 vs. Swiss-Prot
Match: STY17_ARATH (Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 5.1e-16 Identity = 37/46 (80.43%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of Csa3G875940 vs. Swiss-Prot
Match: STY8_ARATH (Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2) HSP 1 Score: 80.5 bits (197), Expect = 7.3e-15 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 1
BLAST of Csa3G875940 vs. Swiss-Prot
Match: HT1_ARATH (Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.1e-09 Identity = 27/46 (58.70%), Postives = 32/46 (69.57%), Query Frame = 1
BLAST of Csa3G875940 vs. Swiss-Prot
Match: Y9963_DICDI (Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 5.6e-07 Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 1
BLAST of Csa3G875940 vs. TrEMBL
Match: A0A0A0LDM8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G875940 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 6.2e-29 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. TrEMBL
Match: M5VWD4_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa003462mg PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 4.6e-16 Identity = 41/46 (89.13%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. TrEMBL
Match: A0A061FDQ8_THECC (ACT-like protein tyrosine kinase family protein isoform 1 OS=Theobroma cacao GN=TCM_034314 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 6.0e-16 Identity = 44/59 (74.58%), Postives = 49/59 (83.05%), Query Frame = 1
BLAST of Csa3G875940 vs. TrEMBL
Match: A0A0D2TSH9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G190600 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-15 Identity = 39/46 (84.78%), Postives = 45/46 (97.83%), Query Frame = 1
BLAST of Csa3G875940 vs. TrEMBL
Match: A0A0D2TMJ4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_009G190600 PE=4 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.0e-15 Identity = 39/46 (84.78%), Postives = 45/46 (97.83%), Query Frame = 1
BLAST of Csa3G875940 vs. TAIR10
Match: AT4G38470.1 (AT4G38470.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 86.3 bits (212), Expect = 7.5e-18 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of Csa3G875940 vs. TAIR10
Match: AT4G35780.1 (AT4G35780.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 84.3 bits (207), Expect = 2.8e-17 Identity = 37/46 (80.43%), Postives = 42/46 (91.30%), Query Frame = 1
BLAST of Csa3G875940 vs. TAIR10
Match: AT2G17700.1 (AT2G17700.1 ACT-like protein tyrosine kinase family protein) HSP 1 Score: 80.5 bits (197), Expect = 4.1e-16 Identity = 36/46 (78.26%), Postives = 40/46 (86.96%), Query Frame = 1
BLAST of Csa3G875940 vs. TAIR10
Match: AT4G31170.1 (AT4G31170.1 Protein kinase superfamily protein) HSP 1 Score: 67.0 bits (162), Expect = 4.7e-12 Identity = 28/46 (60.87%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of Csa3G875940 vs. TAIR10
Match: AT2G24360.1 (AT2G24360.1 Protein kinase superfamily protein) HSP 1 Score: 64.7 bits (156), Expect = 2.3e-11 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 1
BLAST of Csa3G875940 vs. NCBI nr
Match: gi|700204937|gb|KGN60070.1| (hypothetical protein Csa_3G875940 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 8.9e-29 Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. NCBI nr
Match: gi|778686869|ref|XP_011652461.1| (PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis sativus]) HSP 1 Score: 113.6 bits (283), Expect = 1.2e-22 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. NCBI nr
Match: gi|659132907|ref|XP_008466449.1| (PREDICTED: ephrin type-B receptor 3-like isoform X3 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 1.2e-17 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. NCBI nr
Match: gi|659132909|ref|XP_008466450.1| (PREDICTED: serine/threonine-protein kinase HT1-like isoform X4 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 1.2e-17 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of Csa3G875940 vs. NCBI nr
Match: gi|659132903|ref|XP_008466447.1| (PREDICTED: tyrosine-protein kinase Abl-like isoform X2 [Cucumis melo]) HSP 1 Score: 97.1 bits (240), Expect = 1.2e-17 Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|