Csa3G760000 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGATACCTCTCAAGGATTCGGTGCCAGCAGCCCAGAACAAAGTGAAGATTGAGAAGGTAGGAGAGTTCAAGATGGTGTTTGTAGAGACACCAAATATGAGTGAGATCCATTGGGTTCCAGGCAGCATTAACTCCAACAAGTATGTGAAAGAATCTGTTTTATCCCCTTATTCTCGCATCTTTCCTCCCATTCGTTGA ATGATGATACCTCTCAAGGATTCGGTGCCAGCAGCCCAGAACAAAGTGAAGATTGAGAAGGTAGGAGAGTTCAAGATGGTGTTTGTAGAGACACCAAATATGAGTGAGATCCATTGGGTTCCAGGCAGCATTAACTCCAACAAGTATGTGAAAGAATCTGTTTTATCCCCTTATTCTCGCATCTTTCCTCCCATTCGTTGA ATGATGATACCTCTCAAGGATTCGGTGCCAGCAGCCCAGAACAAAGTGAAGATTGAGAAGGTAGGAGAGTTCAAGATGGTGTTTGTAGAGACACCAAATATGAGTGAGATCCATTGGGTTCCAGGCAGCATTAACTCCAACAAGTATGTGAAAGAATCTGTTTTATCCCCTTATTCTCGCATCTTTCCTCCCATTCGTTGA MMIPLKDSVPAAQNKVKIEKVGEFKMVFVETPNMSEIHWVPGSINSNKYVKESVLSPYSRIFPPIR*
BLAST of Csa3G760000 vs. TrEMBL
Match: A0A0A0LDX2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G760000 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.3e-29 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa3G760000 vs. TrEMBL
Match: A0A0A0LW03_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G569370 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 2.1e-19 Identity = 49/55 (89.09%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of Csa3G760000 vs. TrEMBL
Match: A0A0A0LW03_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G569370 PE=4 SV=1) HSP 1 Score: 33.1 bits (74), Expect = 1.6e+02 Identity = 15/19 (78.95%), Postives = 16/19 (84.21%), Query Frame = 1
HSP 2 Score: 83.6 bits (205), Expect = 1.0e-13 Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 1
BLAST of Csa3G760000 vs. TrEMBL
Match: A0A061DXZ7_THECC (Nucleic acid-binding, OB-fold-like protein isoform 1 OS=Theobroma cacao GN=TCM_004501 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-12 Identity = 38/54 (70.37%), Postives = 43/54 (79.63%), Query Frame = 1
BLAST of Csa3G760000 vs. TrEMBL
Match: A0A0D2SY58_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G007300 PE=4 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 4.3e-12 Identity = 36/54 (66.67%), Postives = 43/54 (79.63%), Query Frame = 1
BLAST of Csa3G760000 vs. TAIR10
Match: AT5G63690.1 (AT5G63690.1 Nucleic acid-binding, OB-fold-like protein) HSP 1 Score: 68.6 bits (166), Expect = 1.7e-12 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = 1
BLAST of Csa3G760000 vs. NCBI nr
Match: gi|700203946|gb|KGN59079.1| (hypothetical protein Csa_3G760000 [Cucumis sativus]) HSP 1 Score: 136.3 bits (342), Expect = 1.9e-29 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 1
BLAST of Csa3G760000 vs. NCBI nr
Match: gi|449435653|ref|XP_004135609.1| (PREDICTED: SOSS complex subunit B homolog [Cucumis sativus]) HSP 1 Score: 102.4 bits (254), Expect = 3.0e-19 Identity = 49/55 (89.09%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of Csa3G760000 vs. NCBI nr
Match: gi|449435653|ref|XP_004135609.1| (PREDICTED: SOSS complex subunit B homolog [Cucumis sativus]) HSP 1 Score: 33.1 bits (74), Expect = 2.3e+02 Identity = 15/19 (78.95%), Postives = 16/19 (84.21%), Query Frame = 1
HSP 2 Score: 102.4 bits (254), Expect = 3.0e-19 Identity = 49/55 (89.09%), Postives = 51/55 (92.73%), Query Frame = 1
BLAST of Csa3G760000 vs. NCBI nr
Match: gi|659099487|ref|XP_008450623.1| (PREDICTED: SOSS complex subunit B homolog [Cucumis melo]) HSP 1 Score: 33.1 bits (74), Expect = 2.3e+02 Identity = 15/19 (78.95%), Postives = 16/19 (84.21%), Query Frame = 1
HSP 2 Score: 83.6 bits (205), Expect = 1.5e-13 Identity = 39/54 (72.22%), Postives = 44/54 (81.48%), Query Frame = 1
BLAST of Csa3G760000 vs. NCBI nr
Match: gi|590718070|ref|XP_007050740.1| (Nucleic acid-binding, OB-fold-like protein isoform 1 [Theobroma cacao]) HSP 1 Score: 80.1 bits (196), Expect = 1.6e-12 Identity = 38/54 (70.37%), Postives = 43/54 (79.63%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|