Csa3G644820 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATCTCTAAAAACATTTGGAGAAATGGCAGAAAAATGCCTTGCTGGTGAAGGGAAGATTTGTCCAACAATGAGCAAAGTTCTATGGCACCTAGAATATTCTCTGCAACTCCATGATGCTTGGATCTGCACTAATGATGCACAAAGTTCTTGCGCAGTAAACTCAGAAGGAGCAGAAGCTGAGGAACAGAGGCTAGATCTTGATGGGGAAGAGGAATGCTCCAACATGAAAACTTCAACTCCAACTGATCACTCATCCTAA ATGGCAGAAAAATGCCTTGCTGGTGAAGGGAAGATTTGTCCAACAATGAGCAAAGTTCTATGGCACCTAGAATATTCTCTGCAACTCCATGATGCTTGGATCTGCACTAATGATGCACAAAGTTCTTGCGCAGTAAACTCAGAAGGAGCAGAAGCTGAGGAACAGAGGCTAGATCTTGATGGGGAAGAGGAATGCTCCAACATGAAAACTTCAACTCCAACTGATCACTCATCCTAA ATGGCAGAAAAATGCCTTGCTGGTGAAGGGAAGATTTGTCCAACAATGAGCAAAGTTCTATGGCACCTAGAATATTCTCTGCAACTCCATGATGCTTGGATCTGCACTAATGATGCACAAAGTTCTTGCGCAGTAAACTCAGAAGGAGCAGAAGCTGAGGAACAGAGGCTAGATCTTGATGGGGAAGAGGAATGCTCCAACATGAAAACTTCAACTCCAACTGATCACTCATCCTAA MAEKCLAGEGKICPTMSKVLWHLEYSLQLHDAWICTNDAQSSCAVNSEGAEAEEQRLDLDGEEECSNMKTSTPTDHSS*
BLAST of Csa3G644820 vs. Swiss-Prot
Match: Y1357_ARATH (Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.4e-07 Identity = 30/71 (42.25%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of Csa3G644820 vs. TrEMBL
Match: A0A0A0L9C8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G644820 PE=4 SV=1) HSP 1 Score: 167.2 bits (422), Expect = 8.3e-39 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa3G644820 vs. TrEMBL
Match: A0A0A0KM70_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G525520 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 3.5e-29 Identity = 66/78 (84.62%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of Csa3G644820 vs. TrEMBL
Match: B9SB26_RICCO (Kinase, putative OS=Ricinus communis GN=RCOM_1337350 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.1e-09 Identity = 32/73 (43.84%), Postives = 47/73 (64.38%), Query Frame = 1
BLAST of Csa3G644820 vs. TrEMBL
Match: A0A067KFC0_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_09214 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 6.8e-09 Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 1
BLAST of Csa3G644820 vs. TrEMBL
Match: M5X9T5_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa001294mg PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.9e-09 Identity = 38/85 (44.71%), Postives = 50/85 (58.82%), Query Frame = 1
BLAST of Csa3G644820 vs. TAIR10
Match: AT1G30570.1 (AT1G30570.1 hercules receptor kinase 2) HSP 1 Score: 56.6 bits (135), Expect = 8.0e-09 Identity = 30/71 (42.25%), Postives = 41/71 (57.75%), Query Frame = 1
BLAST of Csa3G644820 vs. NCBI nr
Match: gi|700203310|gb|KGN58443.1| (hypothetical protein Csa_3G644820 [Cucumis sativus]) HSP 1 Score: 167.2 bits (422), Expect = 1.2e-38 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Csa3G644820 vs. NCBI nr
Match: gi|659078091|ref|XP_008439544.1| (PREDICTED: probable receptor-like protein kinase At1g30570 [Cucumis melo]) HSP 1 Score: 140.2 bits (352), Expect = 1.6e-30 Identity = 67/78 (85.90%), Postives = 71/78 (91.03%), Query Frame = 1
BLAST of Csa3G644820 vs. NCBI nr
Match: gi|778721599|ref|XP_011658325.1| (PREDICTED: probable receptor-like protein kinase At1g30570 [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 5.0e-29 Identity = 66/78 (84.62%), Postives = 70/78 (89.74%), Query Frame = 1
BLAST of Csa3G644820 vs. NCBI nr
Match: gi|694434382|ref|XP_009344414.1| (PREDICTED: probable receptor-like protein kinase At1g30570 [Pyrus x bretschneideri]) HSP 1 Score: 72.4 bits (176), Expect = 4.0e-10 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 1
BLAST of Csa3G644820 vs. NCBI nr
Match: gi|657982699|ref|XP_008383396.1| (PREDICTED: probable receptor-like protein kinase At1g30570 [Malus domestica]) HSP 1 Score: 71.2 bits (173), Expect = 8.9e-10 Identity = 38/81 (46.91%), Postives = 51/81 (62.96%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |