Csa3G383770 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGAGCCTTTTTCCCTCAAGCTTCTTCAAATGGAGTGGTCCTCAACCCTCTTAATGCACATCGTCTTCTCATATTTCTCATTTAATTTTCTTTTTAAACTAAGTGAATGGGAAAAGTTTGAAGTGATAGGTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGGGAGGAAAGAGTTTTAA ATGGAGGAGCCTTTTTCCCTCAAGCTTCTTCAAATGGATGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGGGAGGAAAGAGTTTTAA ATGGAGGAGCCTTTTTCCCTCAAGCTTCTTCAAATGGATGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGTTAGTGATGGGAGGAAAGAGTTTTAA MEEPFSLKLLQMDDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDVSDGRKEF*
BLAST of Csa3G383770 vs. Swiss-Prot
Match: DSPP_RAT (Dentin sialophosphoprotein OS=Rattus norvegicus GN=Dspp PE=1 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 5.8e-07 Identity = 30/47 (63.83%), Postives = 30/47 (63.83%), Query Frame = 1
BLAST of Csa3G383770 vs. TrEMBL
Match: A0A0A0LCV5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G383770 PE=4 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.1e-25 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 1
BLAST of Csa3G383770 vs. TrEMBL
Match: D7C1W9_STRBB (Uncharacterized protein OS=Streptomyces bingchenggensis (strain BCW-1) GN=SBI_09052 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.1e-10 Identity = 32/51 (62.75%), Postives = 48/51 (94.12%), Query Frame = 1
BLAST of Csa3G383770 vs. TrEMBL
Match: D7C1W9_STRBB (Uncharacterized protein OS=Streptomyces bingchenggensis (strain BCW-1) GN=SBI_09052 PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 2 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 3 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 4 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 5 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 6 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 7 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 8 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 9 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 10 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
HSP 11 Score: 69.7 bits (169), Expect = 1.5e-09 Identity = 31/53 (58.49%), Postives = 48/53 (90.57%), Query Frame = 1
HSP 12 Score: 70.9 bits (172), Expect = 6.6e-10 Identity = 35/47 (74.47%), Postives = 45/47 (95.74%), Query Frame = 1
BLAST of Csa3G383770 vs. TrEMBL
Match: A0A0T7Q9H5_BURPE (Putative polyketide synthase PksJ OS=Burkholderia pseudomallei GN=pksJ_2 PE=4 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.4e-06 Identity = 29/43 (67.44%), Postives = 39/43 (90.70%), Query Frame = 1
HSP 2 Score: 70.5 bits (171), Expect = 8.7e-10 Identity = 31/46 (67.39%), Postives = 46/46 (100.00%), Query Frame = 1
BLAST of Csa3G383770 vs. TrEMBL
Match: A0A0L8RK34_SACEU (FYV8-like protein OS=Saccharomyces eubayanus GN=DI49_2163 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.9e-09 Identity = 31/46 (67.39%), Postives = 45/46 (97.83%), Query Frame = 1
HSP 2 Score: 65.5 bits (158), Expect = 2.8e-08 Identity = 30/47 (63.83%), Postives = 44/47 (93.62%), Query Frame = 1
HSP 3 Score: 59.3 bits (142), Expect = 2.0e-06 Identity = 28/47 (59.57%), Postives = 40/47 (85.11%), Query Frame = 1
HSP 4 Score: 53.1 bits (126), Expect = 1.4e-04 Identity = 26/47 (55.32%), Postives = 36/47 (76.60%), Query Frame = 1
HSP 5 Score: 40.4 bits (93), Expect = 9.6e-01 Identity = 21/47 (44.68%), Postives = 30/47 (63.83%), Query Frame = 1
HSP 6 Score: 70.1 bits (170), Expect = 1.1e-09 Identity = 31/46 (67.39%), Postives = 45/46 (97.83%), Query Frame = 1
BLAST of Csa3G383770 vs. NCBI nr
Match: gi|700202768|gb|KGN57901.1| (hypothetical protein Csa_3G383770 [Cucumis sativus]) HSP 1 Score: 123.2 bits (308), Expect = 1.6e-25 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 1
BLAST of Csa3G383770 vs. NCBI nr
Match: gi|684176806|gb|AIN47988.1| (hypothetical protein DR93_2153 [Pasteurella multocida]) HSP 1 Score: 82.4 bits (202), Expect = 3.2e-13 Identity = 31/48 (64.58%), Postives = 47/48 (97.92%), Query Frame = 1
BLAST of Csa3G383770 vs. NCBI nr
Match: gi|949621125|ref|WP_057038543.1| (non-ribosomal peptide synthetase [Burkholderia pseudomallei]) HSP 1 Score: 78.6 bits (192), Expect = 4.6e-12 Identity = 39/50 (78.00%), Postives = 48/50 (96.00%), Query Frame = 1
BLAST of Csa3G383770 vs. NCBI nr
Match: gi|949621125|ref|WP_057038543.1| (non-ribosomal peptide synthetase [Burkholderia pseudomallei]) HSP 1 Score: 33.9 bits (76), Expect = 1.3e+02 Identity = 15/44 (34.09%), Postives = 31/44 (70.45%), Query Frame = 1
HSP 2 Score: 75.5 bits (184), Expect = 3.9e-11 Identity = 38/46 (82.61%), Postives = 38/46 (82.61%), Query Frame = 1
BLAST of Csa3G383770 vs. NCBI nr
Match: gi|981805000|ref|WP_059995210.1| (hypothetical protein, partial [Burkholderia stagnalis]) HSP 1 Score: 75.1 bits (183), Expect = 5.1e-11 Identity = 39/48 (81.25%), Postives = 39/48 (81.25%), Query Frame = 1
HSP 2 Score: 68.2 bits (165), Expect = 6.2e-09 Identity = 34/45 (75.56%), Postives = 37/45 (82.22%), Query Frame = 1
HSP 3 Score: 65.5 bits (158), Expect = 4.0e-08 Identity = 33/46 (71.74%), Postives = 33/46 (71.74%), Query Frame = 1
HSP 4 Score: 55.5 bits (132), Expect = 4.1e-05 Identity = 29/46 (63.04%), Postives = 29/46 (63.04%), Query Frame = 1
HSP 5 Score: 34.3 bits (77), Expect = 9.9e+01 Identity = 19/35 (54.29%), Postives = 23/35 (65.71%), Query Frame = 1
HSP 6 Score: 74.7 bits (182), Expect = 6.6e-11 Identity = 37/50 (74.00%), Postives = 48/50 (96.00%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |