Csa3G356080 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTGTATCATTATACTGTCAATGCAGGGATGTGAAGATTGAATACAAACAACTAAAAGAGAAAGTGAGGGAATACACCAAGAGAGATGCACAGTTTTACAGCAACATTTTAGCAAAAATGAACAAATTGAAGCATGTTGAGTCTGGTGTAGATTACAAAACCAAATAGCTAATTTCTCAATCTTATTCTATTCTAAAACGAACCCTTTTGGAAATAAGACATTGTAATTATAGGATTTTGCAGAAATCAGGTGGAAAGCAAGGGGCAGAACCAATGATCATTGATAGCAAAACTTAA ATGCGTGTATCATTATACTGTCAATGCAGGGATGTGAAGATTGAATACAAACAACTAAAAGAGAAAGTGAGGGAATACACCAAGAGAGATGCACAGTTTTACAGCAACATTTTAGCAAAAATGAACAAATTGAAGCATGTTGAGTCTGGTAAATCAGGTGGAAAGCAAGGGGCAGAACCAATGATCATTGATAGCAAAACTTAA ATGCGTGTATCATTATACTGTCAATGCAGGGATGTGAAGATTGAATACAAACAACTAAAAGAGAAAGTGAGGGAATACACCAAGAGAGATGCACAGTTTTACAGCAACATTTTAGCAAAAATGAACAAATTGAAGCATGTTGAGTCTGGTAAATCAGGTGGAAAGCAAGGGGCAGAACCAATGATCATTGATAGCAAAACTTAA MRVSLYCQCRDVKIEYKQLKEKVREYTKRDAQFYSNILAKMNKLKHVESGKSGGKQGAEPMIIDSKT*
BLAST of Csa3G356080 vs. Swiss-Prot
Match: FKB65_ARATH (Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 7.1e-08 Identity = 31/57 (54.39%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of Csa3G356080 vs. Swiss-Prot
Match: FKB70_WHEAT (70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 6.7e-06 Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 1
BLAST of Csa3G356080 vs. TrEMBL
Match: A0A0A0LB26_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G356080 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 4.6e-30 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa3G356080 vs. TrEMBL
Match: A0A0A0L633_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G172920 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 8.5e-16 Identity = 43/57 (75.44%), Postives = 48/57 (84.21%), Query Frame = 1
BLAST of Csa3G356080 vs. TrEMBL
Match: A0A059B1A9_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_H02629 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.8e-13 Identity = 39/57 (68.42%), Postives = 43/57 (75.44%), Query Frame = 1
BLAST of Csa3G356080 vs. TrEMBL
Match: A0A103Y0N7_CYNCS (Peptidyl-prolyl cis-trans isomerase, FKBP-type OS=Cynara cardunculus var. scolymus GN=Ccrd_021384 PE=4 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-12 Identity = 37/57 (64.91%), Postives = 45/57 (78.95%), Query Frame = 1
BLAST of Csa3G356080 vs. TrEMBL
Match: A0A067KJY6_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_13125 PE=4 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.3e-11 Identity = 36/57 (63.16%), Postives = 44/57 (77.19%), Query Frame = 1
BLAST of Csa3G356080 vs. TAIR10
Match: AT5G48570.1 (AT5G48570.1 FKBP-type peptidyl-prolyl cis-trans isomerase family protein) HSP 1 Score: 57.4 bits (137), Expect = 4.0e-09 Identity = 31/57 (54.39%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of Csa3G356080 vs. NCBI nr
Match: gi|700202734|gb|KGN57867.1| (hypothetical protein Csa_3G356080 [Cucumis sativus]) HSP 1 Score: 137.9 bits (346), Expect = 6.6e-30 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Csa3G356080 vs. NCBI nr
Match: gi|659077136|ref|XP_008439052.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis melo]) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-15 Identity = 43/57 (75.44%), Postives = 47/57 (82.46%), Query Frame = 1
BLAST of Csa3G356080 vs. NCBI nr
Match: gi|778679239|ref|XP_011651108.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Cucumis sativus]) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-15 Identity = 43/57 (75.44%), Postives = 48/57 (84.21%), Query Frame = 1
BLAST of Csa3G356080 vs. NCBI nr
Match: gi|702440658|ref|XP_010023594.1| (PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like isoform X2 [Eucalyptus grandis]) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 39/57 (68.42%), Postives = 43/57 (75.44%), Query Frame = 1
BLAST of Csa3G356080 vs. NCBI nr
Match: gi|1009138800|ref|XP_015886778.1| (PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Ziziphus jujuba]) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-12 Identity = 39/57 (68.42%), Postives = 44/57 (77.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|