Csa3G353970 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGACTGCCCACCCCACTTTCCGGTGACCGCAAGTCCCTACAAGTTGCTCCCACTTTTGACAATACTTCGACGGATGGAACCAATTACAATTCATGGCTGGTACGATATTCATTCATTCATTTTATTATTGTTGTTGTTGTTAAATGAGAGATTATATATTTTTAATTGATTAATTAATTAATGTGTATTAGAAAACACATCCTTCTGGGTTGGAATCATTTGACGGGATGATGAAAGGGCTAAAAAGAAAGAAAATTGTTGTGTTTTTGGATTATGATGGAACTCTTTCTCCCATTGTTGATGATCCTGATCGAGCTTTCATGTCTTCTGAGGTAATTTATTCTTTAAGTATTAACTTTACATATATATATATATATATTTTTAATAATATTAGATTCAAATCTTGA ATGGGACTGCCCACCCCACTTTCCGGTGACCGCAAGTCCCTACAAGTTGCTCCCACTTTTGACAATACTTCGACGGATGGAACCAATTACAATTCATGGCTGAAAACACATCCTTCTGGGTTGGAATCATTTGACGGGATGATGAAAGGGCTAAAAAGAAAGAAAATTGTTGTGTTTTTGGATTATGATGGAACTCTTTCTCCCATTGTTGATGATCCTGATCGAGCTTTCATGTCTTCTGAGGTAATTTATTCTTTAAGTATTAACTTTACATATATATATATATATATTTTTAATAATATTAGATTCAAATCTTGA ATGGGACTGCCCACCCCACTTTCCGGTGACCGCAAGTCCCTACAAGTTGCTCCCACTTTTGACAATACTTCGACGGATGGAACCAATTACAATTCATGGCTGAAAACACATCCTTCTGGGTTGGAATCATTTGACGGGATGATGAAAGGGCTAAAAAGAAAGAAAATTGTTGTGTTTTTGGATTATGATGGAACTCTTTCTCCCATTGTTGATGATCCTGATCGAGCTTTCATGTCTTCTGAGGTAATTTATTCTTTAAGTATTAACTTTACATATATATATATATATATTTTTAATAATATTAGATTCAAATCTTGA MGLPTPLSGDRKSLQVAPTFDNTSTDGTNYNSWLKTHPSGLESFDGMMKGLKRKKIVVFLDYDGTLSPIVDDPDRAFMSSEVIYSLSINFTYIYIYIFNNIRFKS*
BLAST of Csa3G353970 vs. Swiss-Prot
Match: TPPI_ARATH (Probable trehalose-phosphate phosphatase I OS=Arabidopsis thaliana GN=TPPI PE=2 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 8.0e-14 Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of Csa3G353970 vs. Swiss-Prot
Match: TPPJ_ARATH (Probable trehalose-phosphate phosphatase J OS=Arabidopsis thaliana GN=TPPJ PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.8e-13 Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 1
BLAST of Csa3G353970 vs. Swiss-Prot
Match: TPPD_ARATH (Probable trehalose-phosphate phosphatase D OS=Arabidopsis thaliana GN=TPPD PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.4e-12 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1
BLAST of Csa3G353970 vs. Swiss-Prot
Match: TPP3_ORYSJ (Probable trehalose-phosphate phosphatase 3 OS=Oryza sativa subsp. japonica GN=TPP3 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.4e-12 Identity = 33/56 (58.93%), Postives = 38/56 (67.86%), Query Frame = 1
BLAST of Csa3G353970 vs. Swiss-Prot
Match: TPP9_ORYSJ (Probable trehalose-phosphate phosphatase 9 OS=Oryza sativa subsp. japonica GN=TPP9 PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.4e-12 Identity = 34/67 (50.75%), Postives = 43/67 (64.18%), Query Frame = 1
BLAST of Csa3G353970 vs. TrEMBL
Match: A0A0A0LB10_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G353970 PE=4 SV=1) HSP 1 Score: 216.9 bits (551), Expect = 1.2e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
BLAST of Csa3G353970 vs. TrEMBL
Match: B9I555_POPTR (Trehalose 6-phosphate phosphatase OS=Populus trichocarpa GN=POPTR_0012s01570g PE=3 SV=2) HSP 1 Score: 93.2 bits (230), Expect = 2.0e-16 Identity = 45/75 (60.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of Csa3G353970 vs. TrEMBL
Match: B9IDX6_POPTR (Trehalose 6-phosphate phosphatase OS=Populus trichocarpa GN=POPTR_0015s02190g PE=3 SV=2) HSP 1 Score: 89.4 bits (220), Expect = 2.9e-15 Identity = 42/65 (64.62%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Csa3G353970 vs. TrEMBL
Match: A0A151TS39_CAJCA (Trehalose 6-phosphate phosphatase OS=Cajanus cajan GN=KK1_009074 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 3.8e-15 Identity = 40/62 (64.52%), Postives = 49/62 (79.03%), Query Frame = 1
BLAST of Csa3G353970 vs. TrEMBL
Match: A0A067ELN0_CITSI (Trehalose 6-phosphate phosphatase (Fragment) OS=Citrus sinensis GN=CISIN_1g036329mg PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 6.6e-15 Identity = 40/61 (65.57%), Postives = 48/61 (78.69%), Query Frame = 1
BLAST of Csa3G353970 vs. TAIR10
Match: AT5G10100.1 (AT5G10100.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein) HSP 1 Score: 77.8 bits (190), Expect = 4.5e-15 Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 1
BLAST of Csa3G353970 vs. TAIR10
Match: AT5G65140.1 (AT5G65140.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-14 Identity = 33/53 (62.26%), Postives = 43/53 (81.13%), Query Frame = 1
BLAST of Csa3G353970 vs. TAIR10
Match: AT1G35910.1 (AT1G35910.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein) HSP 1 Score: 72.0 bits (175), Expect = 2.5e-13 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1
BLAST of Csa3G353970 vs. TAIR10
Match: AT2G22190.1 (AT2G22190.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein) HSP 1 Score: 70.5 bits (171), Expect = 7.2e-13 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 1
BLAST of Csa3G353970 vs. TAIR10
Match: AT4G39770.1 (AT4G39770.1 Haloacid dehalogenase-like hydrolase (HAD) superfamily protein) HSP 1 Score: 70.5 bits (171), Expect = 7.2e-13 Identity = 32/52 (61.54%), Postives = 40/52 (76.92%), Query Frame = 1
BLAST of Csa3G353970 vs. NCBI nr
Match: gi|700202719|gb|KGN57852.1| (hypothetical protein Csa_3G353970 [Cucumis sativus]) HSP 1 Score: 216.9 bits (551), Expect = 1.8e-53 Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
BLAST of Csa3G353970 vs. NCBI nr
Match: gi|449467003|ref|XP_004151215.1| (PREDICTED: trehalose-phosphate phosphatase B-like [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 2.5e-39 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 1
BLAST of Csa3G353970 vs. NCBI nr
Match: gi|659077718|ref|XP_008439346.1| (PREDICTED: probable trehalose-phosphate phosphatase C [Cucumis melo]) HSP 1 Score: 148.7 bits (374), Expect = 5.9e-33 Identity = 70/82 (85.37%), Postives = 75/82 (91.46%), Query Frame = 1
BLAST of Csa3G353970 vs. NCBI nr
Match: gi|566196259|ref|XP_002318381.2| (hypothetical protein POPTR_0012s01570g [Populus trichocarpa]) HSP 1 Score: 93.2 bits (230), Expect = 2.9e-16 Identity = 45/75 (60.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of Csa3G353970 vs. NCBI nr
Match: gi|743922896|ref|XP_011005526.1| (PREDICTED: probable trehalose-phosphate phosphatase 4 [Populus euphratica]) HSP 1 Score: 92.4 bits (228), Expect = 5.0e-16 Identity = 45/73 (61.64%), Postives = 52/73 (71.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|